KEGG   Meiothermus silvanus: Mesil_3141Help
Entry
Mesil_3141        CDS       T01246                                 

Definition
glucan 1,4-alpha-glucosidase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
msv  Meiothermus silvanus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mesil_3141
Enzymes [BR:msv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Mesil_3141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3189834..3192119
Genome map
AA seq 761 aa AA seqDB search
MEAFGVPGISPTWASSSKDLVGTALGTARVWFTLGHGILNEVFWPSTGRPQIRDLGFIVA
REGAWYEVKRVHSYTLSTPAPEVPLPQVVHRGEEYTLELECLVDPNRDVVLVRYRLEGEG
FRLYPLLAPHLGGSGHDNTAWVEGSALYAQKGMAALALLAKPGFTRASAGFVGFSDGWQD
FQRNRAMTWSFSRATGGNVALMGELLAPAGVLALGFAETPEGAHTLAASSLTEDYGAVRD
RYLEGWRAWARGLKIEGASPELTRMARTSTMVLRVHEDTTYPGAVVASLSTPWGSSHDDP
GGYHLVWPRDAVEAGLALLAAGQVQDARRMLAYLLATQQPDGSWPQNFYPDGRAYWQGLQ
LDEVALPVLLAARLEEEGGLAERAQVQRMVQKALGFIAQNGPYSPQDRWEENAGANPFTL
GVQVAALVAGAAFLEEPERSYALSLADAWNARIEEWTFVENTPLDHQHGLRGHYVRIRPP
GTMGLRGRVLVQNRQGEQVAAEELVGLEFFYLVRLGLRSPHDPRVRDTLRLVEALLRVDT
PSGPFYHRYNHDGYGEHADGRPFDGNGVGRAWPLLSGERGHYALLAGEDPLPYLWTMARA
ASLGGLIPEQVWDSPPIPERGLFPGRPSGSAMPLVWAHAEYLKLFLAWQQGRPSEWLQGV
AQRYQSPRPPQILHWRSDTPHRVVRPGQTLQVEATRPFTLHFGFDGWQEVQELPATAVGL
GCFGVQLEPALLQGHRSLEFTRRFEEGWERRDYRVEILQEG
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atggaggcttttggcgtgccgggcatctctcctacctgggcctccagcagcaaggacctg
gtgggcacggccctgggcacggcccgggtctggtttaccctggggcatggcatcctcaac
gaggtcttctggccttccaccggcaggccgcagatccgcgacctaggcttcatcgtggcc
cgggagggggcctggtacgaggtcaagcgggtgcactcctacaccctctcgaccccggcc
cccgaggtgcccctgccccaggtggtgcatcggggcgaggagtacacgctggagctggag
tgcctggtcgaccctaaccgcgatgtggtgctggtgcgctaccggctggaaggggagggc
ttccggctgtatccgctgctggccccccacctgggcggcagcggtcacgacaacaccgcc
tgggtggaagggtcggctctctatgcccagaaagggatggccgcgctggcacttctcgct
aagccggggtttacccgggccagcgcgggttttgtgggcttttccgatggttggcaggat
tttcaacggaacagagccatgacttggagcttcagccgggccacgggaggcaacgtggcc
ctgatgggggagctgctggcccccgcgggggtgctggccctggggtttgccgagaccccg
gagggggcgcacaccctggccgcctcgagcctgactgaagactacggggcggtacgggat
cgctacttggaaggttggcgggcctgggctagggggctcaagatcgagggggcgagcccg
gaactcacccggatggcccgcacctcgaccatggtgctccgggtgcatgaggacaccact
taccccggcgcggtggtggccagcctctccactccctggggttcctcccacgacgatcct
gggggctaccacctggtctggccgcgcgacgcggtggaggctgggctggccctgctggcc
gcgggccaggtgcaagacgcccggcggatgttggcctatctgcttgccacccaacagccc
gacggaagctggccgcagaacttctaccccgatgggcgggcctactggcagggtctccag
ctcgacgaggttgccctgccggtgctgctggcggcgcggctggaggaagagggagggcta
gccgagcgggcccaggtgcagcggatggtgcaaaaggctctcggttttatcgcgcaaaac
ggtccctatagcccccaggaccgctgggaggagaacgccggagccaaccccttcactctg
ggggtacaggtggccgcgctggtggcgggggcagcctttttggaggaacccgagcgaagt
tatgccctctcgttggccgatgcctggaacgcccggatcgaggagtggacgtttgtggag
aataccccccttgaccatcagcacgggctgcggggtcattacgtgcgcatccgacccccg
gggacgatgggcctacggggccgggtgctggtgcagaaccgccagggtgagcaggtagcg
gctgaggagctggtggggctggagtttttctacctggtacggcttgggctgcgctcgccg
catgatccccgcgtccgcgataccctacggctggtggaggctctactgcgggtggatacc
cccagcggtcctttttaccaccgctacaaccacgacggctacggcgagcatgccgacggc
cgcccctttgacgggaacggggtgggccgggcctggcccctcctgagcggggagcggggc
cactatgccctcctggcaggggaagatcccctgccctacctctggaccatggcccgtgcg
gccagcctggggggcctgatcccggagcaggtctgggacagcccgccgatccccgaacgg
ggtctattccccgggcggcccagcggcagcgcgatgcccctggtctgggcccatgccgag
tacctcaagctcttcctggcatggcaacagggccgtcccagcgagtggctccagggggta
gctcagcgctatcaaagcccccgccctccccaaatcctgcactggcgcagcgacacgccc
caccgggtcgtccgccccggccaaaccctccaggtcgaggccacgcggcccttcaccttg
cactttggttttgacggctggcaagaggtacaggagctgcctgctaccgcggtgggcctg
ggttgttttggggttcagctcgagcctgcgctgctgcagggccaccgctcgctcgagttc
acccggcgcttcgaggagggctgggaaaggcgggactacagggtggagattctgcaagag
gggtga

DBGET integrated database retrieval system