KEGG   Meiothermus silvanus: Mesil_3180Help
Entry
Mesil_3180        CDS       T01246                                 

Definition
(GenBank) glycoside hydrolase family 4
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
msv  Meiothermus silvanus
Pathway
msv00052  Galactose metabolism
msv00561  Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Mesil_3180
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mesil_3180
   00600 Sphingolipid metabolism
    Mesil_3180
Enzymes [BR:msv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Mesil_3180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4C Glyco_hydro_4 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: ADH65003
UniProt: D7BEQ7
Position
complement(3232274..3233623)
Genome map
AA seq 449 aa AA seqDB search
MPKITFIGAGSTVFAQNLMGDILSFPELAESTLVLYDINPERLKTSEIVAHKVAQSLGAR
PQIIATTDRVQALEGAHYAINMIQVAGYKPGTVIDFEIPKKYGLRQTIADTLGIGGIMRG
LRTIPVLLEMAREMERLCPGVLHLNYVNPMAMNTWALLKATRIKTVGLCHSVQGTAEQLA
QDIGVPVEEINYLCAGINHMAFYLKFERNGEDLYPRIRAFLESGKTAYRGHGLVKLSDSV
RYEVFRRLGYFVTESSEHFSEYVPWFIKRDRPDLIAKFGIPLDEYIRRCEEQIAGWEELR
AKLEHSTEPLPVRRSHEYGSLIIHSQETGTPRVVYGNVLNHHLIDNLPQGCCVEVPCLVD
KNGVQPTRIGLLPPHLAALMRTNIGVQELTVEAVLSGKREHIYHAAMLDPHTAAELDLEQ
IWNLVDELLEAHGEWIPEPLRSKGCVLPV
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaaatcacttttatcggcgcgggaagtacggtgtttgcccagaacctgatgggc
gatatcctgagctttcccgaactggcggagtccaccctggtgctctacgacatcaacccc
gagcggctcaagacctccgagatcgtggcccataaagtagcccagagcctgggagccagg
ccgcagattatcgccaccaccgaccgggttcaagccctcgagggcgcccattacgccatc
aacatgatccaggtggcaggctacaagcctggcacggtgatcgacttcgagatccctaaa
aagtacggcctgcgccagaccatcgccgacaccttggggatcggtgggatcatgcggggg
ctgcgcaccatcccagtgcttttggagatggcccgcgagatggagcggctgtgcccgggg
gtcttgcacctcaactacgtcaaccccatggccatgaacacctgggccttgcttaaggcc
acccggatcaagacggtggggttgtgccatagcgtgcagggcaccgccgagcagctcgcc
caggatatcggggtgccggtggaggagatcaactacctctgtgccgggatcaaccacatg
gctttttatctcaagtttgagcggaacggggaagacctctacccccggattcgggccttc
ctcgaatccggaaaaaccgcctaccgcggccacggcctggtgaagctctccgatagcgtg
cgctacgaggtgttccgccgcctgggctacttcgtcaccgagtccagcgagcacttcagc
gagtacgtgccctggtttatcaagcgggaccgccccgacctcatcgcgaagttcggcatc
cccttggacgagtacatccgccgctgtgaggagcagatcgcggggtgggaggaactgcgg
gccaagctcgagcacagcaccgagcccctacccgtccgccgcagccacgagtacggctcg
ctcatcatccatagccaggaaaccggcacccctcgagtggtctacggcaacgtgctcaac
caccacctcatcgataacctgccccagggctgttgcgtggaggtcccctgtctggtggac
aaaaacggcgtccagcctacccgaatcggtctcctcccgccccacctggccgccctcatg
cgcaccaatataggcgtgcaggaactcaccgtcgaggcagtactcagcggaaagcgcgag
cacatctaccacgcggccatgctggacccgcacaccgccgccgaactcgacctggagcag
atttggaacttggtagacgaactgctcgaggcccacggcgagtggatcccggaacccctg
cgtagcaaaggctgcgttcttccggtctag

DBGET integrated database retrieval system