KEGG   Meiothermus silvanus: Mesil_3256Help
Entry
Mesil_3256        CDS       T01246                                 

Definition
hypothetical protein
Orthology
K02446  
fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
msv  Meiothermus silvanus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:msv01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:msv00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:msv00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:msv00051]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:msv00710]
Metabolism; Energy metabolism; Methane metabolism [PATH:msv00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pMESIL01:complement(53638..54627)
Genome map
AA seq 329 aa AA seqDB search
MIAVERPTRNLSLDLLRSTEAAALAASRWVGLGNKNDADQAAVDAMRLLLSTIPMRARVV
IGEGEKDKAPMLYNGEELGSGEGPEVDIAVDPIEGTRLAASGQPGAISVIAAAERGGLFD
PGPAFYAAKIVVGPEAKEAIDLTARPKENLRAIAKALGKQVRELTVFVLDKPRHARLIDQ
IRMAGARVSLYTDGDVAGALAAVLPDTGIDVLMGTGGTPEGVLAAVAVKALGGGMQMRLD
PQSEEEHWSLAHHGYDIHRVYTLDELCPAEETHFAATGITEGPFLRGVRYRQHRAITHSL
VIRGHTRTLRYIESHHHLDKLRALSGDLY
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcagtggagcgccccacccgtaacctctccctggatctcttgcgcagcaccgag
gccgccgctctagcggcctcacgctgggtagggctgggcaacaagaacgacgccgatcag
gctgcggtggatgccatgcgtttgctcctgagtaccattcccatgcgggcccgggtggtg
atcggagagggcgagaaggacaaggcccccatgctctacaacggggaggagctgggctca
ggcgagggaccggaggtggatatcgcggtagatcccatcgaggggacccggttggcggcc
tccgggcagccgggcgccatcagcgtgatcgctgcggcggagcggggagggctgttcgat
ccagggcccgccttctatgctgccaagatcgtggtaggaccggaggctaaagaggccatc
gaccttaccgccaggcccaaggagaacctgcgcgcgatcgccaaagccctgggtaagcag
gtgcgcgaacttaccgtcttcgtgctggacaagccgcgccacgcccggttgatcgaccag
atccgcatggcgggggccagggtcagcctgtataccgatggtgacgtagcgggtgccctg
gcggcggtgctgcccgataccgggatcgacgtcctgatgggtaccgggggtacgcctgaa
ggggtgcttgccgcggtcgcggtcaaggccctgggagggggcatgcagatgcggctggat
ccccagagcgaggaagagcactggtctttggcgcatcacggctatgacatccatcgggtc
tacaccctggacgagctgtgcccggctgaggagacccacttcgccgccaccggaattacg
gaagggccgtttctgcggggcgtgcgctaccgccagcacagggccatcacccacagcctg
gtgatccgggggcatacccgtaccctgcgctacattgagtcccatcaccatctggacaag
ctgcgagctttgagcggcgacttgtactag

DBGET integrated database retrieval system