KEGG   Meiothermus silvanus: Mesil_3256Help
Entry
Mesil_3256        CDS       T01246                                 

Definition
(GenBank) hypothetical protein
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
msv  Meiothermus silvanus
Pathway
msv00010  Glycolysis / Gluconeogenesis
msv00030  Pentose phosphate pathway
msv00051  Fructose and mannose metabolism
msv00680  Methane metabolism
msv00710  Carbon fixation in photosynthetic organisms
msv01100  Metabolic pathways
msv01110  Biosynthesis of secondary metabolites
msv01120  Microbial metabolism in diverse environments
msv01130  Biosynthesis of antibiotics
msv01200  Carbon metabolism
Module
msv_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesil_3256
   00030 Pentose phosphate pathway
    Mesil_3256
   00051 Fructose and mannose metabolism
    Mesil_3256
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mesil_3256
   00680 Methane metabolism
    Mesil_3256
Enzymes [BR:msv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Mesil_3256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX Oxidored_nitro YdjM
Motif
Other DBs
NCBI-ProteinID: ADH65072
UniProt: D7BIR6
Position
pMESIL01:complement(53638..54627)
Genome map
AA seq 329 aa AA seqDB search
MIAVERPTRNLSLDLLRSTEAAALAASRWVGLGNKNDADQAAVDAMRLLLSTIPMRARVV
IGEGEKDKAPMLYNGEELGSGEGPEVDIAVDPIEGTRLAASGQPGAISVIAAAERGGLFD
PGPAFYAAKIVVGPEAKEAIDLTARPKENLRAIAKALGKQVRELTVFVLDKPRHARLIDQ
IRMAGARVSLYTDGDVAGALAAVLPDTGIDVLMGTGGTPEGVLAAVAVKALGGGMQMRLD
PQSEEEHWSLAHHGYDIHRVYTLDELCPAEETHFAATGITEGPFLRGVRYRQHRAITHSL
VIRGHTRTLRYIESHHHLDKLRALSGDLY
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcagtggagcgccccacccgtaacctctccctggatctcttgcgcagcaccgag
gccgccgctctagcggcctcacgctgggtagggctgggcaacaagaacgacgccgatcag
gctgcggtggatgccatgcgtttgctcctgagtaccattcccatgcgggcccgggtggtg
atcggagagggcgagaaggacaaggcccccatgctctacaacggggaggagctgggctca
ggcgagggaccggaggtggatatcgcggtagatcccatcgaggggacccggttggcggcc
tccgggcagccgggcgccatcagcgtgatcgctgcggcggagcggggagggctgttcgat
ccagggcccgccttctatgctgccaagatcgtggtaggaccggaggctaaagaggccatc
gaccttaccgccaggcccaaggagaacctgcgcgcgatcgccaaagccctgggtaagcag
gtgcgcgaacttaccgtcttcgtgctggacaagccgcgccacgcccggttgatcgaccag
atccgcatggcgggggccagggtcagcctgtataccgatggtgacgtagcgggtgccctg
gcggcggtgctgcccgataccgggatcgacgtcctgatgggtaccgggggtacgcctgaa
ggggtgcttgccgcggtcgcggtcaaggccctgggagggggcatgcagatgcggctggat
ccccagagcgaggaagagcactggtctttggcgcatcacggctatgacatccatcgggtc
tacaccctggacgagctgtgcccggctgaggagacccacttcgccgccaccggaattacg
gaagggccgtttctgcggggcgtgcgctaccgccagcacagggccatcacccacagcctg
gtgatccgggggcatacccgtaccctgcgctacattgagtcccatcaccatctggacaag
ctgcgagctttgagcggcgacttgtactag

DBGET integrated database retrieval system