KEGG   Meiothermus silvanus: Mesil_3306Help
Entry
Mesil_3306        CDS       T01246                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
msv  Meiothermus silvanus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:msv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mesil_3306
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Mesil_3306
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mesil_3306
Enzymes [BR:msv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Mesil_3306
Exosome [BR:msv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mesil_3306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pMESIL01:complement(98040..99797)
Genome map
AA seq 585 aa AA seqDB search
MSRSIAAVCALALTLGSAWAAKIAIYPYDGAALLAGQRFDLRIEATELKGGLSAYRIALD
GQPLAGLEQTSQGAAQAEWTLRGTFLRSGSHTLEVSLSDASGETKKSVRWEARLNPRLPR
AAKNVILFIGDGMGWNTLNAARIIAQGFSPENGSPRGNLEMESGFGGMATVTTSSFDSFI
VDSANSASSIMTGQKVQVNALNVYPANLKDTLAYPRIETLAEMLKRVRGASIGAVTTTFG
TDATPAMLVAHTRRRGDYQAIADQYFGRGGFGLPLEVMLFGGSRDFIPKSAPGSRRKDDT
DWIAEAQKLGYTFVSTRSELLAAKPQGKLFGLFHIDNFPSYLDRAVWKRPEMLGSFTDMP
YLWEMTQKAVETLSQNPNGFFLMVEGGMVDKFEHPLDWQRGLWDVLELDRAVAWAKQYVA
AHPDTLVVVTADHAHSLSVYGGYDYSKQGREGVGVYQEAKFPTYGDKKDANGFPLPDTAR
GIAVGFAATPDYCETYRGREVYKDPTISDGKGGYVANPEVCKEPGAFLRTGNLDPGSAQG
VHTADPMPLFAFGAGAQLFNGLMDQTEIFFRMAQALGLNPYLERP
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagaagcatcgcagccgtgtgcgccctggccctcaccctgggatcggcctgggca
gccaagatcgccatttacccctacgatggagcggccttgctggcggggcaacgcttcgat
ctacgcatcgaggccacagagctaaaaggcggcctcagcgcctaccgcattgcgctcgac
ggccagccgctggcggggctcgagcagacctcccaaggggccgctcaggccgaatggacc
ctgcgtggcaccttcctgcgctccgggagccacaccctcgaggtaagcctcagcgatgcc
tctggggagaccaaaaaaagcgtccggtgggaggctcgcctgaacccccgcctgccccgt
gcggccaagaacgtcatcctcttcatcggcgacggcatgggctggaataccctcaacgcc
gcccggatcatcgcccagggcttcagcccggaaaacggatcgcccaggggcaacctggaa
atggaaagcggatttggcggtatggccacggtaaccaccagcagcttcgacagcttcatc
gtggattcggccaactcggcctcttccatcatgaccgggcagaaggtgcaggtgaacgcc
ctcaacgtctaccccgccaacctcaaggacaccctggcctacccccggatcgagaccctg
gccgagatgctcaagcgggtgcgcggggccagcattggagcggtgaccaccaccttcggc
accgacgctacccccgccatgctggtagcccacacccggcgccgtggcgactaccaggcc
atcgccgaccagtacttcgggcgcggagggttcggtctgccgctggaggtgatgctcttc
ggcggctcgcgcgacttcatccccaaaagcgcccccggctcgcgccgcaaggacgatacc
gactggatcgccgaggcgcagaagctcgggtacaccttcgtcagcacccgcagcgagctg
ctggcggctaagccccagggcaagctcttcgggctattccacatcgacaacttccccagc
tacctagaccgcgcggtctggaagcggcccgagatgctggggagcttcaccgatatgccc
tacctctgggagatgacccagaaggccgtggagaccctctcgcaaaaccccaacggcttc
ttcctgatggtggagggggggatggtggacaagttcgagcaccccctggactggcagagg
gggctttgggacgtgctcgagctggatagggcggtggcctgggccaagcagtacgtcgcc
gcccaccccgataccctggtagtcgtgaccgccgatcacgcccactcgctatcggtctat
ggcggctacgattactccaagcagggccgggagggggtgggggtgtaccaggaggcgaag
ttccccacctatggcgacaaaaaagacgccaacggcttccccctgcccgacaccgcccgg
gggatcgccgtgggcttcgccgccacccccgactactgcgagacctaccggggccgcgag
gtctacaaagaccccaccatctccgacggcaagggtggctacgtggccaaccccgaggtg
tgcaaggagcccggtgccttcttgcgcaccggtaacctcgatcctggaagtgcccagggg
gtgcacaccgccgaccccatgccgctatttgcctttggggcgggcgcgcagcttttcaat
ggcctgatggatcagaccgagatcttcttccgcatggcccaggcgctcgggttgaacccc
tacctcgagcggccttag

DBGET integrated database retrieval system