KEGG   Meiothermus silvanus: Mesil_3656Help
Entry
Mesil_3656        CDS       T01246                                 

Definition
AAA ATPase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
msv  Meiothermus silvanus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:msv03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pMESIL02:115575..117500
Genome map
AA seq 641 aa AA seqDB search
MHAVSQARIEREVYRKGRFAVLEVELQGRRVRLAGELPPLLPGSCIEGVFTPFSHPRYGL
TYRVEDLREVRSLPEARAWLAERLNLQKAPDPATALQALREGPGVLEGLTPPALKRWLTL
AWPQIQAEWRLVQRGLSPESARLLWRVPPDSLEANPYPYLLEGLTRAEADHLARRHGREG
LAPQGQILEELLEQARQGHTFPPYPHPLPEAARPLLDTLLYREPGRLGLTRYVQAEQAIA
RFFRRRPAPLRLAPPPAGLTQEQRQLWPRVEEGHALLTGGPGTGKSYTCAALLEAAHRAR
LEVVLLAPTGKAAVRLSELADHQAHTIHARLGWDGERFAHGPHHPLSADLVVVDEASMAD
VELLAALVAALSPHTHLLLVGDADQLPPVGPGAPFQDLLRGPTPQVRLTQLQRRAREHPV
TRLSYQFRAGQLEPPHSEEGLSWRLGETSQVLQWLLEDTQRLWGKTRFQVLAPVYRGPLG
IEALNRVLKERLNPGGYPDWRLGGLPVAPGDPLIQLRNDYALGLANGQLMEVQSADAQSL
LVRLDDGSYKPIPRSQSRHLRHAFAISIHRSQGSQWPCVLLVVSREHGAFVNREMLYTGL
TRSQHSAILYGQLEAYRDALARRASGRQTWLSQGGSHDRIP
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcggtttcccaggcccgcatcgagcgcgaggtctaccgcaagggccgcttcgcg
gtgctggaggtggaactccagggacggcgggtacgcctggccggagaactgccccccctg
cttcccggaagctgcatcgagggggtcttcacccccttctcccacccccgctacggcctg
acctaccgggtcgaggacttgcgcgaggtgcgctccctcccggaggcccgcgcctggctg
gccgaacggctgaacttgcagaaagcgcccgatcccgccaccgccctccaggccctgcgc
gaaggaccgggcgtgctggaggggctgaccccgcccgccctcaagcgctggctgaccctg
gcctggccccagatccaggccgagtggcggctggtgcagcgggggctttcccccgagtcg
gcccgcctgctgtggcgcgtcccgccggattccctcgaggccaacccctacccctacctg
ctggaggggctgacccgcgctgaggccgaccacctggcccggcgtcacgggcgggagggg
ctggccccccagggccagatcctggaggaactgctggagcaggcccgccaggggcacacc
ttccccccctacccgcaccccctgcccgaggcggcccggcccttgctcgacaccctcctc
taccgggagccgggccggttgggcctgacccgctacgtccaagccgagcaggccatcgcc
cgcttctttcgccgccgcccggccccgttgcgcctggctcccccgccagcgggcctgacc
caggagcagcgccagttgtggccccgggtggaagagggtcacgccctcctcaccggcggc
cccggcaccggcaagagctacacctgcgcggccttgctggaagccgcccaccgggcccgg
ctggaggtcgtcctgctggcccctaccggcaaagccgcggtgcggctgagcgagctggcc
gaccaccaggcccacaccattcacgcccggctgggctgggacggggagcgcttcgcccac
ggcccgcaccaccccctcagcgccgacctggtggtggtggacgaggccagcatggccgac
gtggaactgctggccgccctggtcgcagccctttccccccacacccacctgctgctggtg
ggcgacgccgaccagctccccccggtgggccccggcgctccctttcaggacctgttgcga
ggccccaccccccaggtgcgcctgacccagcttcagcggcgggcgcgggagcaccccgtg
acccggctctcctaccagttccgcgcgggccagctggaacccccccacagcgaagagggg
ctgtcctggcggctgggggagacttcgcaggtgctccagtggctcctggaggacacccag
cggctgtggggaaagacccgcttccaggtgctggccccggtctaccgcggcccgctgggc
atcgaggccctcaaccgggtcctcaaggagcggctcaatcccggcggctacccggactgg
cggctgggcggcctcccggtggcccccggggatcccctgatccagctgcgcaacgactac
gcgctgggcctggccaacgggcagctgatggaggtgcagtcggcggacgcccagagcctg
ctggtgcgcctcgacgacggcagctacaagcccatcccccgctcccagagccgccacctg
cgccacgccttcgccatcagcatccaccgttcccagggcagccagtggccctgcgtgctg
ctggtggtgtcccgcgagcacggcgcgttcgtcaaccgggagatgctctacaccgggctc
acccgcagccagcacagcgccatcctctacggccagctcgaggcctaccgcgacgcgctg
gcccgccgggccagcggacgtcagacctggctcagccagggaggttcccatgaccgtatc
ccgtga

DBGET integrated database retrieval system