KEGG   Mycoplasma synoviae: MS53_0053Help
Entry
MS53_0053         CDS       T00261                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
msy  Mycoplasma synoviae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:msy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MS53_0053 (recR)
DNA repair and recombination proteins [BR:msy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MS53_0053 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(53791..54375)
Genome map
AA seq 194 aa AA seqDB search
MFNLSLIEEFITKIRKIPGISRKQAEKIVAWILYSKDDEIYELSNYFKKLKDNISFCSFC
NIPQENNNCYICNDTSRENKLLVVENPLIIEKLEKLSLFKGKYFVFKNLVKNEKSLDKFY
LDLSKLLKYCKNFEEVIFGISPTLEGEVTTNLIRKEFEKFQINSSQLAIGIPIGASIDYM
DEITLKFSIKNRQK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacttatcattaatcgaagaatttattacaaaaattagaaaaatcccaggaata
agtagaaagcaagctgaaaaaatcgtcgcttgaattttatattcaaaagacgatgaaatc
tacgagctttctaattactttaaaaaacttaaagataatatttctttttgcagtttttgt
aatattccacaagaaaataataattgttatatttgcaatgacactagccgtgaaaataaa
ttattggtagttgaaaatccactaataatagaaaagcttgaaaagctttctttatttaaa
ggcaaatatttcgttttcaaaaacttagttaaaaatgaaaaatcacttgataaattttat
ttagatttatccaaacttttaaagtattgtaaaaattttgaagaagtaatttttggaatt
tcgccaacgctagaaggcgaagttacaactaacttaataagaaaagaatttgaaaaattt
caaattaattcatcgcagcttgctattggaattccaattggagcttcaattgattacatg
gatgaaatcactttaaaattttcaataaaaaatcgtcaaaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system