KEGG   Mycoplasma synoviae: MS53_0164Help
Entry
MS53_0164         CDS       T00261                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
msy  Mycoplasma synoviae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:msy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MS53_0164 (ruvA)
Enzymes [BR:msy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MS53_0164 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
174530..175126
Genome map
AA seq 198 aa AA seqDB search
MTLYKIGEIVYKNNNNIILESKGEGNLVTICDNSRYSKGEKLKLYLYEVKNDYIQQTYGF
KTFKERLLFTDLISIDKIGPKTAMLILDQNWELVANLIAEGDWKEISKINYISDKSAKLI
CVELKDKWAKIIQNKEVKKFDDITNIKELKQTLNKLGFKASDIDYAVNNISSTKELDLMV
EESINLITTQMHANNQTT
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacgctatataaaataggtgaaatagtttataaaaacaataacaatattattttggaa
tcaaaaggtgaaggaaatctagtaaccatttgtgataactcaagatattcaaaaggcgaa
aagcttaagctatatttatacgaagttaaaaatgattatatccagcaaacttatggattt
aaaacttttaaagaaaggctgcttttcactgatttaatttcaattgataaaatcgggcct
aaaactgcgatgttaattttagatcaaaattgagagctggtggccaatttaatagccgaa
ggggattgaaaagaaatttctaaaattaattatattagcgataaaagtgcgaagctaatt
tgcgtggagctaaaagataaatgagccaaaataattcaaaacaaagaagttaaaaaattc
gatgatatcaccaacatcaaagaactaaaacaaactttaaataaacttggctttaaagca
agcgatatcgactatgcggttaataatatctcttcaactaaagagcttgacttaatggtt
gaagaaagcattaatttaattacaactcaaatgcatgcaaataaccagaccacataa

DBGET integrated database retrieval system