KEGG   Mycoplasma synoviae: MS53_0296Help
Entry
MS53_0296         CDS       T00261                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
msy  Mycoplasma synoviae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MS53_0296 (pfk)
   01230 Biosynthesis of amino acids
    MS53_0296 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MS53_0296 (pfk)
   00030 Pentose phosphate pathway
    MS53_0296 (pfk)
   00051 Fructose and mannose metabolism
    MS53_0296 (pfk)
   00052 Galactose metabolism
    MS53_0296 (pfk)
  Energy metabolism
   00680 Methane metabolism
    MS53_0296 (pfk)
Enzymes [BR:msy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MS53_0296 (pfk)
Protein phosphatases and associated proteins [BR:msy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MS53_0296 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(327690..328670)
Genome map
AA seq 326 aa AA seqDB search
MMKNIAILTSGGDSPGMNPAVVAIVKAAKANNINSYVVYEGYKGLVENNIQSASELNIND
YISRGGTFIYSARYPEFKDKEVRAKAIENLKTKNIEALIVIGGDGSYMGAQKLHEEGVKT
IGLPGTIDNDIKSSDFTIGYDTALNTIVSAVDKIRDTANSHQRIMIVEVMGNQCGDLALY
SGIATGAEIIATSSYTPTPEEIANQALELTKQKNRRSVIIMVSEKRYNINQLAKLVEEKT
KWATRANSLNHIQRGGSPTAQERILASLLGFKAVEFLLDNKSGYALGIQNNDIVGVPILE
ALNMEPVAAKKTLEKTVKINKINKII
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
ataatgaaaaatattgctattttaacatcaggaggagattctcctggaatgaatccagct
gtggttgctattgtaaaagcagctaaagctaataatattaattcttatgtagtttatgaa
ggatataaaggtcttgtagaaaataatatccaaagcgctagtgaattaaatattaatgat
tatatttctagaggtggaacttttatttattcagctagatatccagaatttaaagacaaa
gaagtaagagctaaagctattgaaaatttaaaaactaaaaacattgaagctttaatagta
atcggtggtgatggttcatatatgggagcacaaaaacttcatgaagaaggagttaaaaca
ataggtcttcctggaactatcgataatgatattaaaagctcagattttaccataggctat
gacaccgctcttaatacaatcgtttcagcggttgataaaatcagagacaccgctaatagt
catcaaagaattatgattgttgaagttatgggaaatcaatgtggtgatttagcgctttat
tcaggaattgcaacaggagctgaaattattgcaactagttcatataccccaacaccagaa
gaaatcgcaaatcaagccttagagctaactaagcaaaaaaatcgtcgtagcgttattatt
atggtttctgaaaaaagatataacattaaccagcttgctaagctagttgaagaaaaaacc
aaatgagctacaagagctaattcattaaatcacattcaaagaggcggaagccctacagca
caagaaagaatattagcttcacttcttggttttaaagcagttgaatttttattagataac
aaaagcggatatgcgcttggaattcaaaataacgatattgtcggagttcctattttagaa
gctctaaacatggagccagttgctgctaaaaaaactctagaaaaaacagtaaaaatcaat
aaaatcaacaaaataatataa

DBGET integrated database retrieval system