KEGG   Mycoplasma synoviae: MS53_0446Help
Entry
MS53_0446         CDS       T00261                                 

Gene name
deoA
Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
msy  Mycoplasma synoviae
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MS53_0446 (deoA)
Enzymes [BR:msy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MS53_0446 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(506945..508243)
Genome map
AA seq 432 aa AA seqDB search
MRIVDLIEKKVNKKELTKEEIFFLIENYTKEFVPDYQMAAMLMAILFNSMTYKEISYLTL
AMLNSGKVYDFSDFDQVLVDKHSTGGIGDKTTLAVVPILASLGVYMPKLSGKGLGQTGGT
IDKLESIPGLTTDISIEDFKAQLKEIKCVIAAQSNEIVPADKKLYALRDVTSTVQSIPLI
ASSIMSKKLATGANIILLDVKCGNGAFMKDLKSAKELAQTMINIGKELGVKVIVEITNMS
RPIGKEIGNKNEIIEAINMLSNKGPSDFSKLVFSSCEAILLEMGMVQTEDEARQKIALSI
RTYLALNKFYELVRYQGGNVEVLNDLKKFWNPKYTYEIKADKDGYLNVFNAFTFGIVSMK
LGAGRQTKEDKIDYEAGITLVKQTNEKVSKNEVIFKLHSSNVIDSSLVEELKTAYKIQNN
KVQNKIILERMQ
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgttgatttaatcgaaaaaaaagttaataaaaaagaattaactaaagaagaa
atttttttcttaattgaaaattacactaaagaatttgttcctgattatcaaatggctgca
atgctaatggctattttatttaattcaatgacttacaaagaaataagttatttaacttta
gccatgctaaattcaggtaaagtttatgattttagtgattttgatcaagttttagttgat
aaacactcaaccggtggaattggtgataaaacaactctagccgtagttcctatcctagct
tcgctaggagtttatatgcctaagctttctggaaaaggactaggccaaactggtggaact
atagataagctcgaaagcataccagggctaacaactgatatttcaattgaagattttaag
gcgcaattaaaagagattaaatgcgtaattgcagcgcaaagcaatgaaatagtaccagct
gataaaaagctatacgctctccgtgacgttacttctacagtgcagtctattcctttaatt
gcatcaagtataatgagtaaaaaattagctacaggagctaatattattctgcttgatgtt
aaatgcggcaatggtgcatttatgaaggatctaaaaagcgctaaagagctagctcaaacc
atgataaatattggtaaagagcttggcgttaaagtaatagttgaaataactaatatgtca
cgtcctattggtaaggagataggaaataaaaacgaaataattgaagctattaatatgctt
tcaaataaaggtcctagtgatttttcaaaacttgttttctcttcttgtgaagctattctt
ttggaaatgggaatggtgcaaactgaagacgaagcaagacaaaaaatagcactatcaatt
agaacttatttagctttaaataaattctacgagcttgttagatatcaaggtggaaatgtt
gaagttttaaatgatttgaaaaagttttgaaatccaaaatacacctatgaaatcaaagct
gataaagatggttatttaaatgtttttaacgcctttacttttgggatagtttcaatgaaa
ctcggcgctggaagacaaaccaaagaagataaaatcgactacgaagcaggaattacgtta
gtaaaacaaaccaatgaaaaagtttcaaaaaatgaagttattttcaaacttcattcatct
aatgtaattgattcttcattagttgaagagttaaaaaccgcttataaaattcaaaataat
aaagtacaaaataaaataattttagaaagaatgcaataa

DBGET integrated database retrieval system