KEGG   Mycoplasma synoviae: MS53_0448Help
Entry
MS53_0448         CDS       T00261                                 

Gene name
fpg
Definition
foramidopyrimidine DNA gycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
msy  Mycoplasma synoviae
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:msy00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    MS53_0448 (fpg)
Enzymes [BR:msy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     MS53_0448 (fpg)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     MS53_0448 (fpg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
509040..509885
Genome map
AA seq 281 aa AA seqDB search
MPEYPEVTVVCQSLSKLLLGKKINNCELLSEKFAKNSSVKDFEEFFNNKTFKKINNTGKF
IEFIFDDKSRAIVHLRMEGKFFIRKTSDLEKYRFKHDHIYFHLGNDETLAYNDSRGFGSF
ETISKENKLSVKEIKNLANLPKDVDIDYLYKKLQNTTRSIKTILLDQKLVLGIGNIYADE
TLFASKIFPMEKAKNLSKAQLKTLMDNAQRIMDESIKLGGSTVHSYQSVNGIDGKFQQRL
KVYGRAKLNCLECGSFVKKVKLDFKQNGRGTSYCPNCQNEK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgccagaatatccagaagttactgtcgtttgccagagtttaagcaagcttttattagga
aaaaaaataaataattgcgagctattaagtgagaagtttgctaaaaattcttcagttaaa
gattttgaagaattttttaataataaaacttttaaaaaaataaataacaccggtaaattt
attgaatttatctttgacgataaatcaagagctatagttcaccttcgtatggaaggaaaa
tttttcattagaaaaaccagcgatttagaaaaatatagattcaaacacgatcatatatat
tttcatttaggtaatgacgaaacgctagcatataatgattcaagaggatttggttctttt
gaaacgatttcaaaagaaaataaattaagcgttaaggaaattaaaaatttagcaaatctt
ccaaaagacgttgacattgactatttatataaaaaactgcaaaacacaacaagaagcatt
aaaactattttgctagatcaaaaactagttttaggaattggaaatatctacgctgatgaa
actctttttgcatcaaagattttcccaatggaaaaagcaaaaaatttatcaaaagcgcag
cttaaaactttaatggataacgcccaaagaattatggatgaaagcataaagcttggcgga
tctacagtgcattcatatcaaagcgtaaatggaattgatggtaaattccaacaaagactt
aaagtttatggaagagcaaaattaaattgcctagaatgcggtagctttgttaaaaaagta
aaactagatttcaaacaaaacggaagaggaacatcatattgtccaaattgtcaaaatgaa
aaataa

DBGET integrated database retrieval system