KEGG   Mycoplasma synoviae: MS53_0486Help
Entry
MS53_0486         CDS       T00261                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
msy  Mycoplasma synoviae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:msy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MS53_0486 (tpiA)
   01230 Biosynthesis of amino acids
    MS53_0486 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MS53_0486 (tpiA)
   00051 Fructose and mannose metabolism
    MS53_0486 (tpiA)
   00562 Inositol phosphate metabolism
    MS53_0486 (tpiA)
Enzymes [BR:msy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MS53_0486 (tpiA)
Exosome [BR:msy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MS53_0486 (tpiA)
  Exosomal proteins of bladder cancer cells
   MS53_0486 (tpiA)
  Exosomal proteins of melanoma cells
   MS53_0486 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(571937..572668)
Genome map
AA seq 243 aa AA seqDB search
MNKKLIVGNWKMNSTFSTTKEFLKEFQSLYSLNSKTYNQKATFAVATPFTNLAALKDNDL
NLKLAAQNMSFYEKGAYTGEVSADMLLDLNVSYVILGHSEQRQYHAETDENVNKKARLAL
EKNLTPIVCVGETLEEYLAGKTKEVVKAQLAASLKDLDVTKVIVAYEPIWAIGTGKVATA
QIAQDVCKYIKELTSKQTVVQYGGSVNAKNIFELSSQEDIDGFLVGGASLKATDFSDLML
NLK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaattaatcgttggtaattgaaaaatgaattcaactttttcaactactaaa
gaatttttaaaagaatttcaaagtttatattctttaaattctaaaacttacaatcaaaaa
gctacctttgcagtagcaacaccttttacaaatttagctgctttaaaagataatgattta
aatttaaaactagcagctcaaaatatgtcattttatgaaaaaggagcatatactggtgaa
gtttcagctgatatgcttcttgatttaaatgtaagctacgttattttaggacattcagaa
caaagacaataccacgctgaaaccgatgaaaacgtaaataaaaaagcaagacttgcttta
gagaaaaatttaacaccgatagtatgcgtaggtgagactttagaagaatacctagctggc
aaaaccaaagaagtagttaaagcccaacttgcagcttcactaaaagaccttgacgtaact
aaagtaatagttgcatatgaacctatttgagccattggtactggaaaagtagccaccgct
caaatcgcacaagatgtttgtaagtatatcaaagaattaacttcaaagcaaaccgtagtt
caatatggtggaagcgttaatgctaaaaacatttttgagcttagcagccaagaagatatt
gatggttttttagtaggtggtgcctcactgaaagctaccgatttttcggatctaatgctt
aatttaaaataa

DBGET integrated database retrieval system