KEGG   Mycoplasma synoviae 53: MS53_0486Help
Entry
MS53_0486         CDS       T00261                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
msy  Mycoplasma synoviae 53
Pathway
msy00010  Glycolysis / Gluconeogenesis
msy00051  Fructose and mannose metabolism
msy01100  Metabolic pathways
msy01110  Biosynthesis of secondary metabolites
msy01120  Microbial metabolism in diverse environments
msy01130  Biosynthesis of antibiotics
msy01200  Carbon metabolism
msy01230  Biosynthesis of amino acids
Module
msy_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:msy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MS53_0486 (tpiA)
   00051 Fructose and mannose metabolism
    MS53_0486 (tpiA)
   00562 Inositol phosphate metabolism
    MS53_0486 (tpiA)
Enzymes [BR:msy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MS53_0486 (tpiA)
Exosome [BR:msy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MS53_0486 (tpiA)
  Exosomal proteins of bladder cancer cells
   MS53_0486 (tpiA)
  Exosomal proteins of melanoma cells
   MS53_0486 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AAZ43895
LNCC_Brazil: MS0486
UniProt: Q4A5S6
Position
complement(571937..572668)
Genome map
AA seq 243 aa AA seqDB search
MNKKLIVGNWKMNSTFSTTKEFLKEFQSLYSLNSKTYNQKATFAVATPFTNLAALKDNDL
NLKLAAQNMSFYEKGAYTGEVSADMLLDLNVSYVILGHSEQRQYHAETDENVNKKARLAL
EKNLTPIVCVGETLEEYLAGKTKEVVKAQLAASLKDLDVTKVIVAYEPIWAIGTGKVATA
QIAQDVCKYIKELTSKQTVVQYGGSVNAKNIFELSSQEDIDGFLVGGASLKATDFSDLML
NLK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaattaatcgttggtaattgaaaaatgaattcaactttttcaactactaaa
gaatttttaaaagaatttcaaagtttatattctttaaattctaaaacttacaatcaaaaa
gctacctttgcagtagcaacaccttttacaaatttagctgctttaaaagataatgattta
aatttaaaactagcagctcaaaatatgtcattttatgaaaaaggagcatatactggtgaa
gtttcagctgatatgcttcttgatttaaatgtaagctacgttattttaggacattcagaa
caaagacaataccacgctgaaaccgatgaaaacgtaaataaaaaagcaagacttgcttta
gagaaaaatttaacaccgatagtatgcgtaggtgagactttagaagaatacctagctggc
aaaaccaaagaagtagttaaagcccaacttgcagcttcactaaaagaccttgacgtaact
aaagtaatagttgcatatgaacctatttgagccattggtactggaaaagtagccaccgct
caaatcgcacaagatgtttgtaagtatatcaaagaattaacttcaaagcaaaccgtagtt
caatatggtggaagcgttaatgctaaaaacatttttgagcttagcagccaagaagatatt
gatggttttttagtaggtggtgcctcactgaaagctaccgatttttcggatctaatgctt
aatttaaaataa

DBGET integrated database retrieval system