KEGG   Mycoplasma synoviae: MS53_0636Help
Entry
MS53_0636         CDS       T00261                                 

Gene name
rplP
Definition
50S ribosomal protein L16
Orthology
K02878  
large subunit ribosomal protein L16
Organism
msy  Mycoplasma synoviae
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:msy00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    MS53_0636 (rplP)
Ribosome [BR:msy03011]
 Ribosomal Proteins
  Mitochondria
   Large subunit
    MS53_0636 (rplP)
  Bacteria
    MS53_0636 (rplP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(744031..744450)
Genome map
AA seq 139 aa AA seqDB search
MLQPKRTKYRKPFLQSHDKRKAHKGNKVSFGSHGLQAVTSAWVDSRQIESARIAATRSLG
REGNVIIRIFPHFSKTSKPIGVRMGSGKGSPEKWYTPVKVNTVVFEIQGVSAERAKEALR
LAGHKLPVKWKIIEKEGVN
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaaccaaaaagaactaaatatcgtaaaccatttttacaaagccatgacaaaaga
aaagctcataaaggaaacaaagtttcatttggaagccacggtttacaagccgtaaccagc
gcgtgagtggattctcgtcaaattgaatcagctcgtattgctgcaacccgtagtttaggg
cgtgaaggaaatgtcataattagaatcttccctcacttttcaaaaacttctaagccaatt
ggagttcgtatgggatcaggaaaagggtctcctgagaaatgatacactccagttaaagta
aatacagttgtatttgaaattcaaggagtttctgctgaaagagcaaaagaagcgcttaga
ctagcaggacacaaactaccagttaaatgaaaaatcattgaaaaagaaggagttaattaa

DBGET integrated database retrieval system