KEGG   Mycoplasma synoviae 53: MS53_0636Help
Entry
MS53_0636         CDS       T00261                                 

Gene name
rplP
Definition
(GenBank) 50S ribosomal protein L16
  KO
K02878  large subunit ribosomal protein L16
Organism
msy  Mycoplasma synoviae 53
Pathway
msy03010  Ribosome
Module
msy_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:msy00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    MS53_0636 (rplP)
Ribosome [BR:msy03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    MS53_0636 (rplP)
  Bacteria
    MS53_0636 (rplP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L16 Pro_Al_protease
Motif
Other DBs
NCBI-ProteinID: AAZ44043
LNCC_Brazil: MS0636
UniProt: Q4A5C8
Position
complement(744031..744450)
Genome map
AA seq 139 aa AA seqDB search
MLQPKRTKYRKPFLQSHDKRKAHKGNKVSFGSHGLQAVTSAWVDSRQIESARIAATRSLG
REGNVIIRIFPHFSKTSKPIGVRMGSGKGSPEKWYTPVKVNTVVFEIQGVSAERAKEALR
LAGHKLPVKWKIIEKEGVN
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaaccaaaaagaactaaatatcgtaaaccatttttacaaagccatgacaaaaga
aaagctcataaaggaaacaaagtttcatttggaagccacggtttacaagccgtaaccagc
gcgtgagtggattctcgtcaaattgaatcagctcgtattgctgcaacccgtagtttaggg
cgtgaaggaaatgtcataattagaatcttccctcacttttcaaaaacttctaagccaatt
ggagttcgtatgggatcaggaaaagggtctcctgagaaatgatacactccagttaaagta
aatacagttgtatttgaaattcaaggagtttctgctgaaagagcaaaagaagcgcttaga
ctagcaggacacaaactaccagttaaatgaaaaatcattgaaaaagaaggagttaattaa

DBGET integrated database retrieval system