KEGG   Mycoplasma synoviae: MS53_0636Help
Entry
MS53_0636         CDS       T00261                                 

Gene name
rplP
Definition
50S ribosomal protein L16
Orthology
K02878  
large subunit ribosomal protein L16
Organism
msy  Mycoplasma synoviae
Pathway
Ribosome
Class
Genetic Information Processing; Translation; Ribosome [PATH:msy03010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LNCC_Brazil: 
UniProt: 
Position
complement(744031..744450)
Genome map
AA seq 139 aa AA seqDB search
MLQPKRTKYRKPFLQSHDKRKAHKGNKVSFGSHGLQAVTSAWVDSRQIESARIAATRSLG
REGNVIIRIFPHFSKTSKPIGVRMGSGKGSPEKWYTPVKVNTVVFEIQGVSAERAKEALR
LAGHKLPVKWKIIEKEGVN
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaaccaaaaagaactaaatatcgtaaaccatttttacaaagccatgacaaaaga
aaagctcataaaggaaacaaagtttcatttggaagccacggtttacaagccgtaaccagc
gcgtgagtggattctcgtcaaattgaatcagctcgtattgctgcaacccgtagtttaggg
cgtgaaggaaatgtcataattagaatcttccctcacttttcaaaaacttctaagccaatt
ggagttcgtatgggatcaggaaaagggtctcctgagaaatgatacactccagttaaagta
aatacagttgtatttgaaattcaaggagtttctgctgaaagagcaaaagaagcgcttaga
ctagcaggacacaaactaccagttaaatgaaaaatcattgaaaaagaaggagttaattaa

DBGET integrated database retrieval system