KEGG   Moorella thermoacetica: Moth_0029Help
Entry
Moth_0029         CDS       T00308                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mta  Moorella thermoacetica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mta00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Moth_0029
DNA repair and recombination proteins [BR:mta03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Moth_0029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
31211..31810
Genome map
AA seq 199 aa AA seqDB search
MYYPEPLNKLITALGRLPGIGPKTAQRLAFHLLKVPASEARDLAAAILEARQKTIYCSIC
GNFTDRDPCRLCSDPERDHSCICVVEEARDIIALEKTRQYRGLYHVLQGAISPVDGIGPE
QLRVKELLARLHDGKVKEVILATNADVEGESTALYLDKLLKTLGVKVTRLAYGLPVGGDL
EYADEVTLARAFAGRHELE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtattacccggagcccctcaataaactgattaccgccctgggcaggctacccggaatc
ggccccaagacagcccagcgcctggcctttcatctccttaaagttccggccagcgaagcc
cgggacctggcggcggctatcctggaagcgcgccagaagacaatctattgctccatctgc
ggtaacttcactgacagggatccctgccgcctctgcagtgatccggaaagggatcactcc
tgcatctgtgtggttgaagaagcacgggacattatcgccctggagaaaacacgccagtac
cggggcctgtaccacgtcctccagggagccatatcccccgtggatggtatcggcccggag
cagttaagggtcaaggagctcctggcccggcttcatgacgggaaagtcaaggaggtcatc
ctggccactaatgccgatgtcgagggggaatcgacggccctttacttggacaaactgctg
aaaaccctgggggtaaaggttacccgcctggcctacggcttgcccgtcggcggcgatctg
gaatacgctgatgaggttaccctggcccgggcctttgccggccgccacgaactagaataa

DBGET integrated database retrieval system