KEGG   Moorella thermoacetica: Moth_0072Help
Entry
Moth_0072         CDS       T00308                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mta  Moorella thermoacetica
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mta00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
72508..73365
Genome map
AA seq 285 aa AA seqDB search
MDVLTLPAYGKINLTLKVLGRRSDGYHNLSTIFQSIALADRLTFSRCREGIRLETSGLPV
PQGPENLAYRAAARLQSRYGFPGVRITLKKQIPLAAGLAGGSADAAATLIGVNALFNLGL
TPGQLAREGAALGSDVPFCVIGGTALGRGRGEELSLLPPLPTLWLVLVKPSFGVSTAAVY
RGWDASPGQTPMEAPDEERALAAIRRGDRAGIMASLGNDLEAVTCRLYPEVMAIKMRLLA
EGAERAVMCGSGPAVFGVAADGETARRIASRLQETYPETIVTRTL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
ttggatgtcctcaccttgccggcctatggtaaaataaatctgactttaaaggtcctcggg
cggcgttccgacggttatcacaacctgagcaccatcttccagtcaattgccctggcggat
agactcactttcagccgttgccgggaaggaatacgcctggaaacctcagggctgccggta
ccgcaaggaccggaaaacctggcctaccgggcagcagcccggttgcagtcccgttacggt
tttcccggggtgcggataaccctgaagaagcaaatccccctggcagccggcctggccggg
ggcagcgctgatgctgcggctaccctgataggtgtgaatgccctttttaacctgggcctg
acccccggccagctggcccgggaaggggcggccctggggtcggacgtccctttttgcgtt
attggtggtacggccttaggacgggggcggggggaagaactctcccttttacctcccctc
ccgacactatggctggtactggtaaaaccgtccttcggggtcagtacggcagccgtatac
cggggttgggatgccagccccggccaaacccccatggaggcccccgacgaggaaagggcc
ctggcggccattaggcggggcgaccgggcaggaattatggcatccctgggtaatgacctg
gaagcagtcacctgccgcctgtacccggaagttatggccattaagatgcgtctcctggcc
gaaggggcagagcgggcggtgatgtgcggcagcggcccggcggtcttcggggtggctgcc
gatggagaaaccgccaggcgcatcgcctcccggttacaggagacttaccccgaaactata
gtcacccggaccttatga

DBGET integrated database retrieval system