KEGG   Moorella thermoacetica: Moth_0376Help
Entry
Moth_0376         CDS       T00308                                 

Definition
pyruvate ferredoxin oxidoreductase subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mta  Moorella thermoacetica
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Moth_0376
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Moth_0376
   00020 Citrate cycle (TCA cycle)
    Moth_0376
   00620 Pyruvate metabolism
    Moth_0376
   00640 Propanoate metabolism
    Moth_0376
   00650 Butanoate metabolism
    Moth_0376
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Moth_0376
   00680 Methane metabolism
    Moth_0376
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Moth_0376
Enzymes [BR:mta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Moth_0376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
380851..381399
Genome map
AA seq 182 aa AA seqDB search
MLQLKLYGLGGQGVVTAAKVLASAIAIQEGRYAQAVPAYGHERRGAPVYADLIVDDEPIL
VKSFVYQPDYVLIFDLAVIEKGVNVTEGAHKNTCFVANSDKAPIEYPFSQGFGPVYYADA
TKIALEVLNIEIPNSAMLGAFAATGVVKIDSVCAALQEFFQGKAGDKNVEAARRCYTSIQ
RL
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgttacaactgaaattatatggcttgggagggcagggagtagtaactgcggccaaagtt
ctggcatcagctatcgctattcaggaaggcaggtatgctcaagccgttcctgcctacggt
cacgagcggcggggagcccctgtatatgctgatttgatagttgatgatgaacctattttg
gtcaaatcatttgtttatcaaccggattatgtattgatatttgatcttgcagtcatcgag
aaaggggtcaatgtaactgagggggcccataagaatacctgttttgtagctaatagcgat
aaagcgccgattgaatatccttttagccagggtttcggtcctgtttactacgctgatgct
acgaaaatagccttggaggttctgaacatagagattcccaattccgcaatgttgggggcc
tttgccgctacaggtgtagtcaaaattgattcagtttgtgcagccctccaagagtttttc
cagggaaaggcaggggataagaatgttgaagcagctagaaggtgttacacctcaatccag
cgactataa

DBGET integrated database retrieval system