KEGG   Moorella thermoacetica: Moth_0378Help
Entry
Moth_0378         CDS       T00308                                 

Definition
pyruvate ferredoxin oxidoreductase subunit alpha (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
mta  Moorella thermoacetica
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Moth_0378
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Moth_0378
   00020 Citrate cycle (TCA cycle)
    Moth_0378
   00620 Pyruvate metabolism
    Moth_0378
   00640 Propanoate metabolism
    Moth_0378
   00650 Butanoate metabolism
    Moth_0378
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Moth_0378
   00680 Methane metabolism
    Moth_0378
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Moth_0378
Enzymes [BR:mta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Moth_0378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
381674..382891
Genome map
AA seq 405 aa AA seqDB search
MATRKLLDGNGAAAEAMRMARVQVISAYPITPQSPIAEKLAEYVANGTLKAKYVRVESEH
TAMSVAIGAQLTGVRACTATSSVGLALMHEMLGVASGCRVPIVMAVINRSLVSPWSLWCD
HQDSMAERDSGWIQLYVENPQEVLDTMFMAYRLAEDPRVLLPVMVCLDGFFLSHTPAALI
VPDQETVDSFLPPYRPSNLYLDPDDPMFINDLTPSSDFTEMRYQQKQAFDQVLQVLPEIQ
DEFARVFGRQYSMVEAYRCEDAEVVLVTLGSMSGTAKYVVNELRKKGQKVGVLKIICFRP
FPAKLIREALKHVPVVGVMDRSAGLGAEGGPVWTEISAALGCLRQGPQVISFIGGLGGRD
LAPHIMEKAFEELLAIKRGIKTYQGSCWIDVRDDALRLREVSQGV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccagaaaactgttagatgggaacggcgcagcagctgaggccatgcgcatggcg
agggttcaggttatatctgcatatcctatcacaccccagagccctattgcggaaaaattg
gcagagtatgttgctaatggaacgttaaaagccaagtatgtacgggtggaatctgagcac
acagctatgtcggtggcaattggagcccagctaacaggggttcgagcttgcacggcaacc
tcatctgttggcctggctttaatgcatgagatgctcggagtggcttcgggttgtcgggta
cccattgtgatggcggtgattaatcgctctttagtaagtccatggagcctttggtgcgac
catcaagatagcatggccgaaagggattcagggtggattcaattatatgtagaaaaccct
caagaagtcctcgataccatgtttatggcctaccggctggcggaagaccccagggtattg
cttccagttatggtatgtttggacgggtttttcctatctcatacgcctgcagcgttgata
gtaccggatcaagaaacagttgactccttcctaccgccataccggccttctaatctatat
ctagatcctgatgatcctatgtttataaatgacttgaccccatcttctgattttacggag
atgcggtaccagcagaagcaagcctttgatcaagttttacaggtattaccggagatccag
gatgagtttgcccgtgtatttggtcggcaatattcaatggtagaggcttatcgttgcgag
gatgctgaagtagtactggtaaccctggggtcaatgtcgggaacggcaaagtatgtggtc
aatgaactccggaaaaaggggcaaaaagtcggcgtgcttaaaatcatctgcttccgtccg
tttccagccaaacttatacgggaagcattaaagcatgtaccagttgtaggtgttatggat
cggagtgctgggctgggggcggaaggtggtccggtgtggactgagattagcgcagcctta
ggttgcttgcgtcaagggcctcaagtaattagttttataggcgggcttggcggccgtgac
ctggctcctcacattatggaaaaagcttttgaagaattactggcaattaagcgggggata
aaaacttatcaaggcagctgctggattgatgttcgagatgatgcattgagactgcgggag
gtgtcacaaggtgtatga

DBGET integrated database retrieval system