KEGG   Moorella thermoacetica: Moth_0408Help
Entry
Moth_0408         CDS       T00308                                 

Definition
(RefSeq) GTP cyclohydrolase
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
mta  Moorella thermoacetica
Pathway
mta00790  Folate biosynthesis
mta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Moth_0408
Enzymes [BR:mta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Moth_0408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-GeneID: 3832349
NCBI-ProteinID: YP_429285
UniProt: Q2RLE7
Position
complement(412946..413503)
Genome map
AA seq 185 aa AA seqDB search
MDKEKIRQAVRMIIEAVGEDPDREGLRETPRRIADMYEEIFAGINRDPGEELTVVFDEHH
EEMVLVKDIPLYSICEHHFLPFLGRAHVAYIPRGKITGLSKLARVVDIAARRPQVQERLT
SQIADIIMEKLNPYGVVVVIEAEHLCMSMRGIKKPGSLTITSAVRGLFRRDQAARAEAMS
LIQGR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggataaggaaaagatccgccaggcggtacgcatgattattgaagctgtcggtgaggac
ccggaccgggaaggcctgcgggagacgccccgccgtatagctgatatgtatgaggaaatc
tttgccggtattaaccgtgaccccggcgaggaattgacggttgtcttcgacgaacaccac
gaggaaatggtactggtaaaggatatacctctctattctatctgcgaacaccacttccta
cccttcctgggcagggcccatgtagcttacattccccggggtaaaattaccggtttaagc
aaactggcccgggtagtggacatcgccgcccgccggccccaggtccaggagcgtttaacc
tcccagatagccgatattatcatggaaaagttaaatccctacggcgtagtcgttgtcatt
gaagccgaacacctttgcatgagcatgcgcggcataaaaaaaccaggctccctgaccatt
acctccgccgtccggggtcttttccgccgcgaccaggccgcccgggcggaagctatgtcc
cttatccagggtcgctaa

DBGET integrated database retrieval system