KEGG   Moorella thermoacetica: Moth_0562Help
Entry
Moth_0562         CDS       T00308                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mta  Moorella thermoacetica
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Moth_0562
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Moth_0562
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Moth_0562
Enzymes [BR:mta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Moth_0562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
584614..585750
Genome map
AA seq 378 aa AA seqDB search
MTERECRLALSQARRLVIKVGTSTLTHKTGKLNLGRMERLVRELVDQVNAGRQVVLVTSG
AVGAGMGRLGLKEKPRTLPEKQAAAAVGQGLLMHMYEKFFSDYGLLVAQVLLTRADLADR
SRYLNSRHTLAALLRLGVVPIVNENDTVAVEEIRVGDNDTLSALVAGLVDADILFLLTDT
GGLFTANPVTSDDAVLLPCVTEITPEIEALAGGAGSTWSTGGMATKIQAARLATSFGIPV
VIASGLQAGQIEAVLKGEEIGTIFLPREHRAHTRKRWLAYAPAVQGQIQVDAGAARAICK
NGKSLLPGGVIAVDGDFDQGAIVSIVDPAGKEIARGMANYPAAAISRIKGRKTGEIGEIL
GYKDYDEIVHRDNLIVLG
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
ttgacggaaagggagtgccggctggctttgagccaggcgcggcggctggtaataaaggtg
gggaccagtaccctgacccataaaacgggcaaactaaacctgggacggatggagcgtctg
gtgcgggagctggtggatcaggtcaacgccggccgccaggtggtcctggtaacctccgga
gccgtgggagccggtatgggccgcctgggtttgaaagaaaagccccggaccctgccggaa
aaacaggccgctgccgccgtgggccaggggctgctcatgcatatgtacgaaaagttcttc
agcgattacggcctgctggtagcccaggtgcttttgacccgggccgacctggccgaccgc
agccgctacctaaattcccgccataccctggcggccctcctgcgcctgggagttgtaccc
attgtcaacgagaacgacaccgtagcggttgaggaaatccgcgtcggggataatgacacc
ctctccgccctggtggccgggctggtagacgcggatatcctgtttttactgactgatacc
ggaggcctctttaccgccaacccggttaccagtgacgacgctgtcctgctcccctgcgtg
acggagattacgccggagatagaagccctggccgggggggcgggttccacctggtcaacg
gggggcatggccactaagatccaggccgcccgcctggccaccagcttcggcatcccggtg
gtcatcgccagcggtctccaggccgggcaaatcgaagccgtcctgaagggtgaggaaata
ggcactattttcctgccccgggaacatcgggcccacaccaggaaacgctggctcgcctat
gctccggccgtccaggggcaaatccaggttgacgccggggcagcccgggcaatatgtaaa
aatggcaagagcctcctccccggtggcgttattgcggtggatggtgatttcgaccagggg
gctatagtaagtatcgttgatcccgctggtaaagagatcgcccggggtatggccaactat
ccggcagcggctatttctcggattaaaggcaggaaaacgggcgagattggcgaaatctta
ggctataaggattacgacgagattgttcaccgggacaatctaattgtcctggggtag

DBGET integrated database retrieval system