KEGG   Moorella thermoacetica: Moth_0743Help
Entry
Moth_0743         CDS       T00308                                 

Definition
(RefSeq) response regulator receiver (CheY-like) modulated CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
mta  Moorella thermoacetica
Pathway
mta02020  Two-component system
mta02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mta00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Moth_0743
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Moth_0743
Enzymes [BR:mta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Moth_0743
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Moth_0743
Two-component system [BR:mta02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Moth_0743
Bacterial motility proteins [BR:mta02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Moth_0743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-GeneID: 3831135
NCBI-ProteinID: YP_429604
UniProt: Q2RKH8
Position
779376..780650
Genome map
AA seq 424 aa AA seqDB search
MNWPVRVLVVDDSAFSRRLVTDILQADPDIQVVGYARNGREALEKVASLQPRVVTLDQEM
PVMDGLTTLTALMAGNPVAVIMLSSHTAAGAAVTIKALELGAVDFIPKPAPGDSLDDFTR
QLTEKVKAAARVPVTRLCRGKNCRENTPAPFISPRPGREEAVAAVTGSAAATAAIGSRLS
PGRSPGGKEGVAGAVSAGSTRGEAIRPGKGTPAAIKGAVAAGAGRLPGRRPGIEVVAIGT
STGGPAALRQVLTALPGNLPAGIVIVQHMPAGFTGPLARRLDELAALEVREAAAGDILRP
GLALLAPAGRQMLLERHGDAVQVHLAAEAGITTLFKPSVDALFLTVAREYGPRSLGVILT
GMGNDGLRGLRAIKEQGGTVIAQDEATSVVYGMPRAAVEAGLADLVLPLEDIAPAIVALV
TGAG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtgaactggccagttagggtcctggtcgttgacgattccgccttcagccgccggctggta
acagatatcttgcaggccgacccagacattcaggtggtgggttatgcccgcaacggcagg
gaagccctggagaaggtcgcctccctgcagccccgggtcgtgaccctggaccaggaaatg
ccggtcatggacgggctgacgacgctgacggccctcatggccgggaaccccgtggcggtt
attatgctatcgtcccatacggcggccggggcggcggtgaccatcaaagcacttgaactg
ggcgccgtcgattttatccccaagccggcaccgggcgatagcctggacgattttaccagg
cagctgacggaaaaggttaaagccgccgccagggtgccggtgacacgcctctgccgggga
aaaaactgccgggaaaacaccccggcaccttttatttctccccggcccggccgggaagaa
gcggtggctgcagttaccgggtcggctgcggctaccgcggcgattggtagccgcctttcg
cctggtcggagtcccggcgggaaagagggggttgccggcgccgtatccgccgggagcacc
cggggggaggccatacgtcccggtaaagggacgcctgcggccataaaaggcgctgtcgct
gccggtgccggccggctgcccggccggcgtcccggcatcgaagtggtggctatcggtacc
tcgacgggaggaccggcggccctgcgtcaggtactgaccgccctgccaggcaacctgcca
gccggcatcgtgattgtccagcatatgccggccggcttcaccggtcccctggcgcggcgc
ctggatgaactggcggccctggaggtacgggaggcggcggccggcgacatactccgcccc
ggcctggccctcctggccccggccggccggcagatgctcctggagcggcacggcgacgcc
gtgcaggtgcacctggccgccgaggccgggatcaccaccctttttaaaccctcggtggac
gccctcttcctaaccgtggccagggagtacggtccccgcagcctgggcgtcatcctgacg
ggcatgggcaacgacggcctgcggggcctcagggccatcaaagaacagggcggcacagtg
atcgcccaggacgaggccaccagcgttgtctacggcatgccccgggcggcggtggaggcc
ggcctggccgacctggtcctgcccctggaagacatcgccccggccatcgtagccctggtg
accggagcaggttaa

DBGET integrated database retrieval system