KEGG   Moorella thermoacetica: Moth_0743Help
Entry
Moth_0743         CDS       T00308                                 

Definition
response regulator receiver (CheY-like) modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mta  Moorella thermoacetica
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mta02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mta02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
779376..780650
Genome map
AA seq 424 aa AA seqDB search
MNWPVRVLVVDDSAFSRRLVTDILQADPDIQVVGYARNGREALEKVASLQPRVVTLDQEM
PVMDGLTTLTALMAGNPVAVIMLSSHTAAGAAVTIKALELGAVDFIPKPAPGDSLDDFTR
QLTEKVKAAARVPVTRLCRGKNCRENTPAPFISPRPGREEAVAAVTGSAAATAAIGSRLS
PGRSPGGKEGVAGAVSAGSTRGEAIRPGKGTPAAIKGAVAAGAGRLPGRRPGIEVVAIGT
STGGPAALRQVLTALPGNLPAGIVIVQHMPAGFTGPLARRLDELAALEVREAAAGDILRP
GLALLAPAGRQMLLERHGDAVQVHLAAEAGITTLFKPSVDALFLTVAREYGPRSLGVILT
GMGNDGLRGLRAIKEQGGTVIAQDEATSVVYGMPRAAVEAGLADLVLPLEDIAPAIVALV
TGAG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtgaactggccagttagggtcctggtcgttgacgattccgccttcagccgccggctggta
acagatatcttgcaggccgacccagacattcaggtggtgggttatgcccgcaacggcagg
gaagccctggagaaggtcgcctccctgcagccccgggtcgtgaccctggaccaggaaatg
ccggtcatggacgggctgacgacgctgacggccctcatggccgggaaccccgtggcggtt
attatgctatcgtcccatacggcggccggggcggcggtgaccatcaaagcacttgaactg
ggcgccgtcgattttatccccaagccggcaccgggcgatagcctggacgattttaccagg
cagctgacggaaaaggttaaagccgccgccagggtgccggtgacacgcctctgccgggga
aaaaactgccgggaaaacaccccggcaccttttatttctccccggcccggccgggaagaa
gcggtggctgcagttaccgggtcggctgcggctaccgcggcgattggtagccgcctttcg
cctggtcggagtcccggcgggaaagagggggttgccggcgccgtatccgccgggagcacc
cggggggaggccatacgtcccggtaaagggacgcctgcggccataaaaggcgctgtcgct
gccggtgccggccggctgcccggccggcgtcccggcatcgaagtggtggctatcggtacc
tcgacgggaggaccggcggccctgcgtcaggtactgaccgccctgccaggcaacctgcca
gccggcatcgtgattgtccagcatatgccggccggcttcaccggtcccctggcgcggcgc
ctggatgaactggcggccctggaggtacgggaggcggcggccggcgacatactccgcccc
ggcctggccctcctggccccggccggccggcagatgctcctggagcggcacggcgacgcc
gtgcaggtgcacctggccgccgaggccgggatcaccaccctttttaaaccctcggtggac
gccctcttcctaaccgtggccagggagtacggtccccgcagcctgggcgtcatcctgacg
ggcatgggcaacgacggcctgcggggcctcagggccatcaaagaacagggcggcacagtg
atcgcccaggacgaggccaccagcgttgtctacggcatgccccgggcggcggtggaggcc
ggcctggccgacctggtcctgcccctggaagacatcgccccggccatcgtagccctggtg
accggagcaggttaa

DBGET integrated database retrieval system