KEGG   Moorella thermoacetica: Moth_0832Help
Entry
Moth_0832         CDS       T00308                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mta  Moorella thermoacetica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Moth_0832
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Moth_0832
   00052 Galactose metabolism
    Moth_0832
   00500 Starch and sucrose metabolism
    Moth_0832
   00520 Amino sugar and nucleotide sugar metabolism
    Moth_0832
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Moth_0832
   00524 Butirosin and neomycin biosynthesis
    Moth_0832
Enzymes [BR:mta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Moth_0832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
862831..863778
Genome map
AA seq 315 aa AA seqDB search
MCLLGIDLGGTSIKAGLVDINGKILKKGQVPTGAGEGTTAVLKRIKNLARDLAGEQGLAL
GELEGIGIGIPGSVDVARGLVHLAPNLFWRDFSLRDELAALLDLPVAIENDAHVAALGEM
WQGAGRGYTSLLMVTIGTGIGSGLIIDGRVHHGLFGYGAEMGHIKMVCDGRQCHCGGHGC
LETLASATAMVKSFREYLAAGYPSMLSDRPELGAKEILAAAAGGDELAGRVIDEAACYLG
TALANAVLLVGPEAIIIGGGPAQAGEVILDPIRKHLAAAMGTWQLKQVPVLQAALGNDAG
IIGAAYLAMKTSSQY
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
ttgtgccttttgggtatcgatctcggcggtacatcaattaaggccgggctggtggatata
aacggaaagattctgaaaaaaggacaggtgcctacgggggccggtgaaggtacaaccgca
gttttaaagcgcatcaagaacctggcccgggacctggccggtgaacagggtctggctctg
ggtgaactcgaagggatcggtatcggtattcccggatcggttgatgtggccagggggttg
gtccacctggctcccaatctcttctggcgcgatttctccctccgggatgaactggcagcc
ttactggatctacctgtggctattgaaaatgacgcccacgttgccgccctgggggagatg
tggcagggagccggccggggatatacctccctcctcatggtaaccattggcacgggtatc
ggctcaggactgattattgacggtcgcgtccatcacggccttttcggttatggagcggag
atggggcatataaaaatggtctgtgacggccggcagtgtcactgtggcggccatggctgc
ctggagaccctggcttcggccacagctatggtaaagtctttccgggagtacctggcagcg
ggttacccatccatgttatcggataggcccgaacttggggcgaaggagatcctggcagcc
gccgccgggggcgacgaactggctggccgcgtcatcgacgaggccgcctgctatttggga
acagccctggccaatgccgtcctcctggtggggccggaagcaataattatcgggggggga
ccggcccaggccggggaggtaatcttagatcctatccgcaaacacctggctgcagccatg
ggaacctggcagcttaagcaagtaccggtcctacaggctgccctgggtaatgatgcaggt
attatcggcgccgcttatctggctatgaagacgagctcacaatattga

DBGET integrated database retrieval system