KEGG   Moorella thermoacetica: Moth_0887Help
Entry
Moth_0887         CDS       T00308                                 

Definition
ATPase
Orthology
K01537  
Ca2+-transporting ATPase [EC:3.6.3.8]
Organism
mta  Moorella thermoacetica
Brite
Enzymes [BR:mta01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.8  Ca2+-transporting ATPase
     Moth_0887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
919289..922087
Genome map
AA seq 932 aa AA seqDB search
MQSRPWYQLSPEEALMVLGVDAGRGLATIEARRRLEEKGPNQLQARPGVPPYRLFLSQFQ
DLMVLVLLAATAVSAFLGEVADAITIVAIVIINAILGFIQEYRAERSLEALKEMAAPEAR
VRRDGEIRRVPAREIVPGDILLLESGDRVAADALVLTGSNLQADEAALTGESTPVPKAPG
ALAGEVALGDRRNMVHQGTVITGGRGVAVVVATGMATEFGKIAGLLQEVEAEETPLQKRL
AALGRWLVLACLAICIAVVVAGTLRGEDLYGMFLAGVSLAVAAIPEGLPAIVTVCLALGV
QKMVQRQAIIRKLPAVETLGCATVICSDKTGTLTRNQMTVRRVWVGGRSLQVSGTGYNPR
GEYQEKGRRAAVTGDLKMLLTIAAQCNNAQLQKAGLTIGGWLRGGGGKRDKGEKKGGGIF
GKLFDGRDGGEWTISGDPTEGALLVAAAKGGLWRERLEREEPRLAEIPFDSDRKRMSVIC
RVGKGLRAYVKGAPDVIFDLCDTILLDGQVVPLDAARRREIQEENEAMASRALRVLAVAY
RDLEPGTDLQAAAVEKNLVLVGLIGMIDPPRTEAAAAIQVCRQAGIKVVMITGDHQVTAR
AVARELGLPAGEGEVLNGQQLEAMDDADLARMAPGVNVYARVAPHHKLRLVRALKASGHI
VAMTGDGVNDAPAIKEADIGIAMGQSGTDVTREAAAMILADDNFATIVAAIEEGRGIYDN
VRKFIRYLLSCNIGEVMTMFVAVISGLPLPLLPIQILWMNLVTDGLPAMALGIDNKEPGL
MKRPPHPPGESVFARGLGKAMAFLGLQIGLATLGVFILGLYLGDGDLITARTLAFTTLVM
AQLFAVFECRSEHLSPFAVGYFSNPYLVMAVAASLAMQLLVLYLPPLQVVFKTVPLNLFH
WGVILLAAGWRTLLGGVNYYLVAQVRRLVWER
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcacgaccatggtaccagttgagtcctgaagaagccttaatggtcctgggggtc
gacgccggccggggtctggcgacaatagaggcccggcggcgcctggaagaaaaggggccc
aaccagctccaggcccggccgggggtcccgccgtacaggttatttctgtcccaatttcag
gacctcatggtcctggtcctcctggcggccacggccgtatcagccttcctgggggaagtg
gccgatgccattaccatcgtcgccatcgtcatcatcaacgccatcctgggctttatccag
gaataccgggccgaacgttccctggaggctttgaaggagatggcggcgcccgaggccagg
gtgcggcgggacggcgagatccgccgggtaccggcgcgggagatagtgcccggcgacatc
cttctcctggaaagcggcgaccgggtggccgccgacgccctggtcctcaccggcagcaac
ctccaggccgatgaagcggccctgacgggcgagtcgaccccggtgcccaaggcgcccggg
gccctggcgggcgaggtggccctgggcgaccggcgtaatatggtgcaccagggaacggtg
attaccggcggccggggcgtggctgtggtggtggctaccggcatggctacggagttcggc
aagatcgccggcctgctccaggaagtggaggccgaggagacccccctgcaaaaacgcctg
gccgccctgggccgctggctggtcctggcctgtctggccatctgcatagctgtggtggtt
gccggtaccttacgcggggaagacctctacggcatgttcctggcgggcgtcagcctggcg
gtggcagccatccccgagggcctgccggccatcgtcaccgtctgcctggccctgggggtg
cagaaaatggtacagcgccaggctattatccgcaaactgccggctgtagaaactctgggt
tgtgccacggtcatctgctcggacaaaaccggcaccctgacccggaaccagatgacggtg
cgtcgggtctgggtgggaggccgcagcctccaggtaagcgggacgggctataacccccgg
ggggaataccaggagaagggccggcgggcagccgtcaccggggacctgaagatgcttctg
accatagccgcccagtgcaacaacgcccagctgcaaaaggcaggccttaccatcggcggc
tggctgcgcgggggcgggggtaaaagggataaaggtgagaagaagggcggcggtattttc
ggtaagcttttcgacggccgcgacggcggcgaatggaccatcagcggcgacccaacggaa
ggcgccctgctggtggcggccgccaagggcggtctctggcgggaacggctggaacgggag
gaaccccggctagccgagatcccctttgattccgaccgcaagcgtatgagcgtcatctgc
cgggtgggtaaaggcctcagggcctatgtcaagggcgccccggacgtcatcttcgacctc
tgcgacaccatcctcctggacgggcaggtcgtgcccctggatgccgcccggcgccgggag
atccaggaggagaatgaagccatggccagcagggccctgcgggtcctggccgtggcctac
cgcgacctggagcccgggacggaccttcaggcggcagcagtggagaaaaacctggtcctg
gtggggctcataggtatgatcgacccgccccggaccgaggcggcggcggcgatccaggtc
tgccgccaggcgggaatcaaggtggtcatgattaccggcgaccatcaggtcaccgcccgg
gccgtggcccgggaactgggactgccggcaggggagggtgaggtcttaaacggccagcag
ctggaagccatggacgatgccgacctcgcccggatggcgccgggggtcaatgtctacgcc
cgggtggcgccccaccataagctgcgcctggtgcgggccctgaaggccagcggccatatc
gtggccatgaccggggacggcgttaacgacgctccggccattaaagaggccgacatcggc
atcgccatggggcagagcggtaccgatgtaacccgggaggccgccgccatgatcctggcc
gacgataatttcgccaccatcgtggccgccatcgaagagggacgtggtatctatgacaac
gtccgtaaatttatccgttacctgctctcgtgtaatatcggcgaggtaatgaccatgttc
gtggccgtcatcagcggcctgcccctgcccctgctgcccatccagatcctctggatgaac
ctggtgaccgacggcctgccggccatggccctggggatagacaataaagaaccgggcctc
atgaaacggccgccccacccgccgggggaaagcgtctttgcccgcggcctgggtaaggcc
atggccttcctgggtctgcagataggcctggctaccctgggtgtctttatcctgggctta
tacctgggcgacggcgatctcatcaccgcccgcaccctggcctttaccaccctggtcatg
gcccagctcttcgccgtctttgagtgccgctcggaacacctgtccccctttgcggtaggt
tacttctccaacccctacctggtaatggcggtggccgcttctctggccatgcagcttctg
gtgctctacctgccgcccctccaggttgtttttaaaacagttcctttgaatcttttccac
tggggcgttatcttgctggccgccggctggcgcaccctcctggggggtgttaattactac
ctggtggcccaggtccggcgcctggtttgggagcgttaa

DBGET integrated database retrieval system