KEGG   Moorella thermoacetica: Moth_1041Help
Entry
Moth_1041         CDS       T00308                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mta  Moorella thermoacetica
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mta00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1068326..1069483
Genome map
AA seq 385 aa AA seqDB search
MAKEITVLGSTGSIGRQTLEVVAAHPGRFRVAALVAARNDELLAAQVRRFRPRLAVLLDE
ERARVLAEMVSDPGIRILAGEEGLMAAACLEGVELVVAAMVGIRSLKAILAALEAGKDIA
LANKEVLVAAGQLVMDRARRLSRQIIPVDSEHSAIFQCLRQGGRVAEVIITASGGPLRQM
PRAEMANVTPEQALNHPTWVMGPKITIDSATLMNKGLEVIEAKHLFNLDFDQIKVLIHPQ
SVVHALVRYSDGALFAQLGPADMRLPIQYALTWPERWDLDVQPLDLAALGHLEFALPDLE
RFPCLELALQAGRAGGTYPAVLSAADEVAVEYFLAGKITLTAISQVVGRVLDEHQPEPVP
DLEGILAADAWARRRAGAVAEGLSF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaagagataactgtactgggatcaacgggttccattggccggcagaccctggag
gttgttgctgcccaccccggcaggttcagggtcgccgccctggtagcagccaggaatgac
gagcttctggccgcccaggtgcgcaggttccggccccgcctggcggttcttttggatgaa
gagcgggcccgggtcctggccgaaatggtcagcgaccccggaatccgcatcctcgccggg
gaagagggcctgatggccgccgcctgcctggaaggagtggaactggtggtggcggccatg
gtcggcattcgcagcctgaaagccattctggcggccctggaggcgggaaaagatatcgcc
ctggccaacaaagaggtcctggtggcggccggtcaactggtcatggaccgggcccggcgc
ctcagccgccagattatacccgtggatagcgagcactcggccatcttccagtgcttgcgc
cagggaggccgggtggcagaggtaataatcactgcctccggaggacccctgcggcagatg
ccccgggccgagatggctaacgttactccagagcaggctttaaaccatcccacctgggtg
atggggccgaagataaccatagattccgcgaccctgatgaacaaggggctggaggtaatt
gaagccaaacatctctttaacctcgattttgatcaaatcaaggtcttgattcatccccag
agcgttgtacacgccctagtgcgttacagcgacggggctctttttgcccaactggggccg
gccgatatgcgcctgcccatccagtatgccctgacctggccggagcgttgggatctggac
gtgcagcctctggatctggcagcactgggacacctggaatttgctctgccggacctggag
cgtttcccctgcctggagctggcgctccaggcaggtcgtgccgggggcacttacccggcg
gtcctgagcgctgccgatgaagtggcggtggaatatttcctggccgggaagataaccctt
accgccatcagccaggtggtaggacgggtcctggatgagcatcaaccggagcctgtaccc
gaccttgaaggcatcctcgccgccgatgcctgggcccgacggcgggcaggagcagtagct
gaaggattgtcgttttaa

DBGET integrated database retrieval system