KEGG   Moorella thermoacetica: Moth_1234Help
Entry
Moth_1234         CDS       T00308                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mta  Moorella thermoacetica
Pathway
mta00010  Glycolysis / Gluconeogenesis
mta00030  Pentose phosphate pathway
mta00051  Fructose and mannose metabolism
mta00052  Galactose metabolism
mta00680  Methane metabolism
mta01100  Metabolic pathways
mta01110  Biosynthesis of secondary metabolites
mta01120  Microbial metabolism in diverse environments
mta01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Moth_1234
   00030 Pentose phosphate pathway
    Moth_1234
   00051 Fructose and mannose metabolism
    Moth_1234
   00052 Galactose metabolism
    Moth_1234
  Energy metabolism
   00680 Methane metabolism
    Moth_1234
Enzymes [BR:mta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Moth_1234
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Moth_1234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 3833176
NCBI-ProteinID: YP_430091
UniProt: Q2RJ41
Position
complement(1273746..1274975)
Genome map
AA seq 409 aa AA seqDB search
MLTGNCVVAQSGGPTAVINNSLGGVIEAALGSEAIKEVYGARHGVLGILREDFCDLRRED
PASIQGLRYTPGAALGSCRYQLKNQEDYDRLLDIFRRYNIRYFFYIGGNDSMDTAAKVNR
LALEEGYDLRVIGIPKTIDNDLPQTDHCPGYGSAAKYLATSVLEMGLDLKCIVTSTKVAI
VETMGRNTGWLAAATALARRRPGDAPHYIYLPEVAFDMAAFLADVERAYRQYGTALVVVS
EGLVDKNGNYVFNDAATVDVFGHQRLGGLGQFLLNKIERELNLKGRVILPATSQRSAMHL
ASRTDAEEAWAVGRVAVEAAVKGASGQMVAIRRLEGDTYQVTYELVDLDQVANKEKKLPR
AWINEQGNDVTDHFINYVRPLIQGEVSIPFPNGLPAYVNLACHPVKDPD
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
ttgctaacagggaactgtgttgtggcccagtcgggcggaccaacagcggtcattaacaat
agcctggggggtgtaattgaagccgccctgggcagtgaagctataaaggaggtttatggc
gcccgccacggtgtcctgggtatcctgcgggaagatttctgcgacttgcgccgggaagat
cctgccagcattcagggcctgcgctacacacccggagcagctcttgggtcctgccggtac
cagttaaaaaaccaggaggactatgaccgactcctggatatcttccgccgctacaatatc
cgctattttttctacattggcggcaatgactccatggatacggccgcaaaggtcaaccgg
ctggccctggaggaaggatatgacctgcgggtcatcggcatccccaaaacaattgataat
gatctgccccagacggatcactgccccggttacggcagcgccgccaaatacctggccacc
agcgtcctggaaatggggcttgatctgaaatgcatcgtgacctctaccaaggtggccatt
gtggaaaccatgggtcgcaacaccggctggctggcggcggctacagccctggcccggcgc
cggcccggcgacgccccccattatatctacctgccggaggtggcctttgatatggccgcc
ttcctggcggatgtggaaagagcctaccggcaatacggtaccgccctggtggttgtatct
gaaggcctggtagataaaaacggtaattatgtatttaacgatgccgccaccgtagatgtt
ttcggccaccagcgcctggggggattggggcagttcctgttaaataaaatcgagagggag
ttaaacctgaagggccgggtaatcctcccggcaaccagccagcgcagcgccatgcacctg
gcctcccggacggatgctgaagaagcttgggccgtaggccgggtagccgtagaagcggcc
gtaaagggggccagcggccagatggtggccataaggcgcctggaaggtgatacttatcag
gtaacctacgaacttgtggaccttgaccaggtggccaataaagaaaaaaagctcccccgg
gcctggatcaacgagcaggggaacgatgtgactgaccattttattaactacgttcgcccc
ctgattcagggggaagtaagcattcctttccccaacggccttcctgcttatgtgaacctg
gcctgtcacccggttaaagatccagactag

DBGET integrated database retrieval system