KEGG   Moorella thermoacetica: Moth_1306Help
Entry
Moth_1306         CDS       T00308                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mta  Moorella thermoacetica
Pathway
mta00260  Glycine, serine and threonine metabolism
mta00750  Vitamin B6 metabolism
mta01100  Metabolic pathways
mta01110  Biosynthesis of secondary metabolites
mta01120  Microbial metabolism in diverse environments
mta01230  Biosynthesis of amino acids
Module
mta_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Moth_1306
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Moth_1306
Enzymes [BR:mta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Moth_1306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 3831792
NCBI-ProteinID: YP_430162
UniProt: Q2RIX0
Position
complement(1349153..1350199)
Genome map
AA seq 348 aa AA seqDB search
MNWPGVIRAYREFLPVTEATPLITLEEGNTPLIAAGNLSRELGLKLYFKYEGLNPSGSFK
DRGMVMAVAKAMENGSKAIMCASTGNTSASAAAYAARCGLKCSVLIPEGNIALGKLAQAL
FYGARVIAIQGNFDDALTLVRNITSRYPITLVNSINPFRIEGQKTAAFEICDVLGEAPDY
LAIPVGNAGNITAYWKGFNEYYQAGRSHTLPKMIGFQAEGAAPIVRGEVVPNPETVATAI
RIGNPASWQPAVRAAKDSGGFIDCVSDDEILAAQRLLATAEGIFAEPASAASLAGVLKYA
KKGYFHKDDRVVCVLTGHGLKDPNIAIKQVGEPISLPVDEARVLEIVL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgaactggcccggagttattcgtgcctaccgggagttcctgccggtgacggaggcgact
cccttgattactttagaggaggggaatacccccctgattgccgccgggaacctttcccgg
gaactggggctaaaactatacttcaagtatgaaggcctcaacccgagcggttcctttaag
gatcggggcatggtcatggctgtcgccaaggccatggagaacggttccaaggccataatg
tgcgcttccacgggcaacacctcggcttcggcagcggcctatgccgcaagatgtggttta
aaatgcagcgtcctgatccctgagggcaatatcgccctgggaaaactcgcccaggccctt
ttttatggggccagggtcatagctatccagggcaattttgacgatgccctgaccctggtg
cgcaacatcacctcccgttaccccattactctggttaattccatcaatcccttccgcatt
gaagggcaaaaaacggccgccttcgagatctgcgacgtgctgggggaggctccggattac
ctggccattcctgtaggtaacgccggcaatatcactgcctattggaagggctttaacgag
tattaccaggccggccgtagccataccctgccgaagatgatcggcttccaggccgaaggc
gcagcacccattgtgcggggagaagtagtgccgaacccggaaaccgtagccacggccatc
cgcatcggcaacccggccagctggcaaccggccgtccgggcagctaaagactctggcggg
tttatcgattgcgtgagtgatgacgaaatcctggcagcccagcgcctgctggcaacggcg
gaaggcatcttcgccgaaccggcttccgccgcctccctggccggggtgctcaagtatgct
aaaaagggttatttccataaggatgatagggtggtgtgcgtcctcaccgggcatggcctt
aaagatcccaacatcgccatcaaacaggtaggcgagcccatctccctgccggtggatgaa
gccagggttctggagatcgtactataa

DBGET integrated database retrieval system