KEGG   Moorella thermoacetica: Moth_1336Help
Entry
Moth_1336         CDS       T00308                                 

Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mta  Moorella thermoacetica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Moth_1336
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Moth_1336
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Moth_1336
Enzymes [BR:mta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Moth_1336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1382545..1383327)
Genome map
AA seq 260 aa AA seqDB search
MGVERITAAFAARKKEGRKALIVYLCAGDPSLEVTGQAVRELAGAGVDLIELGVPFSDPV
ADGPVIQAASKRALAAGVTLPEILELVKSLRSGLAVPLILMSYYNPLLQYGLERLTADLA
AAGVDGLIVPDLPLEENPPLRQTLEPAGLALIPLVAPTTPGERLARIAATARGFIYCVSL
TGVTGVREGLPPGIDEYLAGVRAVTDLPLGIGFGIGSPDQARLLAPMGDGIIVGSALVDV
LYQEGLPAALRLVERLRHAL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttgaaagaataactgctgcctttgccgcccggaaaaaagagggacgcaaagcc
ctcatcgtctatctctgtgccggcgacccttccctggaggttaccgggcaagctgtcagg
gaactggctggcgccggggtggacctcattgagctgggggtacccttttctgaccccgtg
gccgatggtccggtcatccaggctgccagcaagcgtgcccttgccgccggggtaaccctg
cccgaaatcctggaattggtaaagagcctgcgctcggggttggctgtccccttgatcctc
atgagctactataaccctttgctgcaatatggactggaacggttaactgccgatctggcc
gctgccggggtggatggtttgattgtacccgatctgcccctggaagaaaacccaccttta
agacaaaccctggaaccggcggggctggccctgattcccctggtggccccgacgaccccc
ggggaacgtttggcccggattgccgccacagcccggggatttatctactgcgtttccctt
accggggtaacaggcgtccgggaaggcttgccgccgggaatagacgagtacctggcaggg
gtgcgggcggtaactgacctgcccctgggaataggtttcggcatcggcagtcccgaccag
gccaggctcctggcccctatgggcgacggcattattgtcggcagcgccctggtcgacgtc
ctgtatcaagaaggcttaccggccgccctccggctggtagaaaggctccggcacgcttta
tag

DBGET integrated database retrieval system