KEGG   Moorella thermoacetica: Moth_1591Help
Entry
Moth_1591         CDS       T00308                                 

Definition
(RefSeq) pyruvate ferredoxin oxidoreductase subunit beta (EC:1.2.7.1)
  KO
K19071  
oxalate oxidoreductase subunit beta [EC:1.2.7.10]
Organism
mta  Moorella thermoacetica
Brite
Enzymes [BR:mta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.10  oxalate oxidoreductase
     Moth_1591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1626153..1627097)
Genome map
AA seq 314 aa AA seqDB search
MLDRIASIKKAPDEEYYVPGHRTCAGCGPALTYRLVAKAAGPNTIFIGPTGCMYVANTSY
GCGPWRVPWIHAQITNGGAVASGIEAAYKAMIRKKKTDAEFPNIIVMAGDGGAVDIGLQA
LSAMLYRGHDVLFICYDNESYANTGIQTSPTTPYGANTTFTPPGEVVPEGKKLFPKDNPK
VIAHGHPELKYVATASIGWPVDLMNKVRKGLNQEGPAYIHIHAPCPKGWQFPADKTIEMA
KLAVQTGMFQLYEYENGEYKLSVKVDKRKPVSEYMKLQKRFAHLKPEHIAKMQAFVDARC
AEVGITVPVVASNA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgctggatcggattgcatctattaaaaaggcacctgatgaggaatactatgttcccggg
catcgtacctgtgccggctgcggcccggccctgacctatcgcctggtggccaaagccgcc
ggtcccaacaccatcttcattggtcccaccggctgcatgtacgtggccaataccagctac
ggctgcggtccctggcgggtaccctggatccatgcccagatcaccaatggcggcgccgtg
gcctccggtattgaggccgcctataaggctatgatccgcaagaagaagaccgacgccgag
ttcccgaacattatcgttatggccggtgatggcggcgccgtcgatatcggcctccaggca
ctgtcggccatgctctatcgcggtcatgacgtcctctttatctgctacgataacgagtcc
tatgccaataccggtattcagacctccccgacgacgccctacggggctaatacgactttt
accccgcctggtgaggtggtaccggagggcaagaagctcttcccgaaggataaccccaag
gttatcgcccacggtcacccggaactgaagtatgtcgccacggcctccatcggctggccg
gtagacctgatgaacaaggtccgtaagggcttaaaccaggaaggtccggcctatatccac
atccacgctccttgccccaagggctggcagttcccggccgacaagaccattgaaatggcc
aaattggccgtccagacgggcatgttccagctctacgaatatgagaatggtgagtataaa
ctgtcggttaaagtcgataaacggaaaccggtcagcgagtacatgaaactccagaagcgg
tttgctcacctgaagcccgagcatatcgccaagatgcaggcctttgtcgacgcccgctgc
gctgaagtaggtatcaccgtgccggtagtcgcttccaacgcttaa

DBGET integrated database retrieval system