KEGG   Moorella thermoacetica: Moth_1592Help
Entry
Moth_1592         CDS       T00308                                 

Definition
(RefSeq) pyruvate flavodoxin/ferredoxin oxidoreductase-like protein
  KO
K19070  
oxalate oxidoreductase subunit alpha [EC:1.2.7.10]
Organism
mta  Moorella thermoacetica
Brite
Enzymes [BR:mta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.10  oxalate oxidoreductase
     Moth_1592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1627127..1628314)
Genome map
AA seq 395 aa AA seqDB search
MGKVRNISGCVAVAHGVRLADVDVICSYPIRPYTGIMSELARMVADGELDAEFVHGEGEH
AQLSVVYGASAAGARVFTGSSGVGVTYAMEVYSPISGERLPVQMAIADRTLDPPGDFGEE
HTDAECCRDQGWIQGWASTPQEALDNTLIYYRVGEDQRVLLPQYACLDGYFVSHILGPVD
IPDEAQVKEFLPPYKNHHVLDPRKPQIIGPQIEPAMGPPLQYQRYQAVKGVHKVLEEACD
EFARIFGRKYDPYLDEYLTDDAEVIIFGQGAHMETAKAVARRLRNLGEKVGVARLRTFRP
FPTEQIKERLSKFKAIGVLDVSANFGISCSGGVLLSELRAALYDYGDKVKTVGFVAGLGG
EVVTHDEFYRMFQKLKEIAKTGKVEQTSYWIPFEL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagtaaggaatatctctggatgtgtggcggtagcacatggtgtgcggttagcc
gatgtcgacgttatctgttcctatcccatccggccttataccggtatcatgtccgagctg
gcacggatggttgccgacggcgagttggatgccgaatttgtccatggcgaaggtgaacac
gcccagttgagtgtcgtttacggcgcttcggctgccggagcacgggtattcaccggtagt
tccggtgtcggcgtaacctatgccatggaagtctattcacctatctctggtgaacgttta
ccggtacagatggccattgccgaccggaccctggacccgcccggtgactttggtgaggaa
cataccgatgccgagtgttgccgggaccagggctggatccagggttgggcctccactccc
caggaagccctggataacaccttgatttactaccgggtaggtgaagaccagcgggtcttg
ttgccccagtatgcctgcctggacgggtacttcgtcagccatatcctaggcccggtggat
attcccgacgaggcccaggtgaaagagttcctgccgccttacaagaatcaccatgtcctc
gatcccaggaagccccagattatcggccctcaaattgagccggccatgggacctcccctc
caataccagcgttaccaggccgttaaaggcgtgcacaaggttctagaagaggcctgtgac
gaattcgcccggattttcggccgcaagtacgatccctaccttgatgaatacctgactgac
gatgccgaggttataatcttcggccagggcgcccacatggagacggctaaagcggtagcc
cggcgcctgcgcaaccttggtgaaaaggtaggagtagcgcggctacgtaccttccggccc
ttcccgacggaacaaattaaagagcgactttctaaattcaaggctattggtgtcctcgat
gtttcggccaacttcggcatttcctgcagcggcggcgtcctcctgtccgaactgcgggcc
gccctctatgactacggcgacaaagtaaagaccgtaggctttgtagccggcctaggcggc
gaagtcgtcacccacgatgagttctaccgcatgttccagaaactaaaggagatcgccaag
acaggtaaagtcgagcagacctcttattggatcccctttgaattataa

DBGET integrated database retrieval system