KEGG   Moorella thermoacetica: Moth_1593Help
Entry
Moth_1593         CDS       T00308                                 

Definition
(RefSeq) 2-oxoacid:acceptor oxidoreductase subunit delta
  KO
K19072  
oxalate oxidoreductase subunit delta [EC:1.2.7.10]
Organism
mta  Moorella thermoacetica
Brite
Enzymes [BR:mta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.10  oxalate oxidoreductase
     Moth_1593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1628336..1629283)
Genome map
AA seq 315 aa AA seqDB search
MSTKDLFAEPNLKQITVWARGVVMNKDARDIVVALTEAAAKEGKYVQAWENYVDLPDRIY
VPVRAYARISSDPIESKYIYENETPDIVVLVEESLIKGVPILKGIRPGSTLVVNTKRSID
TILEFLGDTGNLAQIVTVDANSMAEAVMTLSGAEGATDATGIGAGIAAPIAGAVVKATGI
VDVENLAAVVKNPAAMRRGYAEAQVRQLPPHEAVEEAAVSATELLRQMPFAGTVPSPVTE
NEGMVTGNWRIQRPIIDREACTECYTCWIYCPDSCITRTEEGPVFNMKYCKGCGLCTAVC
PSGALTNVPELDFKD
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
ttgtccaccaaagatctctttgctgaacccaatctcaagcagattactgtgtgggcccgg
ggcgttgtcatgaacaaggacgcccgtgatatcgtggtggccctgacagaagcggctgcc
aaagagggtaaatatgttcaggcctgggagaactatgttgacctccccgaccggatctac
gtcccggtaagggcctatgcccgcatcagcagcgatcccattgaaagcaaatacatttac
gagaatgagactcccgacattgttgttttagttgaagaatccctgatcaaaggagtgccc
atactgaagggcatccgtccgggtagtaccctggttgtaaataccaaacgttccatagat
actatccttgagttcctgggtgataccggcaatctggcccaaatcgtaacggtggatgcc
aacagtatggccgaggctgtcatgactttgtctggcgctgaaggcgctactgacgctacg
ggtattggcgccggcatagcggctcccattgcgggtgctgttgtcaaggctacaggtata
gttgatgttgaaaacctcgccgctgtggtcaagaatcccgccgccatgcgccggggctat
gcggaagcccaggtgcgccagctgccgccccatgaagcagttgaggaagcggccgtatca
gcgactgaattgttgaggcaaatgccctttgccgggacggttccctcaccggtaacggag
aatgagggcatggtaaccggcaactggcgcatccaaaggcccattatcgaccgggaagcc
tgtaccgaatgttatacctgctggatctactgccccgattcctgcatcaccaggaccgaa
gaaggaccggtatttaatatgaagtactgcaagggctgcggcctctgtacggcggtctgc
cccagcggcgccctgactaatgtaccggaacttgacttcaaagattaa

DBGET integrated database retrieval system