KEGG   Moorella thermoacetica: Moth_1701Help
Entry
Moth_1701         CDS       T00308                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mta  Moorella thermoacetica
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mta03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1738603..1739211)
Genome map
AA seq 202 aa AA seqDB search
MIGYLRGRLHLVTPEGILLETGGIGWLVRTVTNRSWPAPGTEIAVYTQLVVREDAMELYG
FTRPEELHLFTLLRGVNGIGPRGALQILGAAKPEQLSRAIAAGDSAFLTALPGIGAKKAQ
RLLLELKDAVLKSGLVDGTETEAIPAGGGDNDEALAALLALGYSREEIGPILARVRQELG
NAAPTTAVLQAVLKTFGRGGGD
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgggtacctgcggggtaggttacatctggtaacaccggagggtatcctcctggag
accggagggatcggctggctggtacgtacagtgaccaatcgttcctggccggcccccggt
acggagatagctgtctacacccagctggtggtcagggaagacgccatggaattatatggt
tttacccggccggaggaactgcaccttttcaccctccttagaggcgtaaatggcatcggg
ccccggggcgccctccagattttgggggctgccaagccggaacagctgtcccgggccatt
gccgccggcgatagtgcctttctgaccgccctgccgggaatcggggccaagaaggcccag
cggttactcctggaattgaaggacgcggttttaaaatccggcctggtagacggtacggag
actgaggccataccggcaggaggcggggataatgatgaagccctggccgccctgttggcg
ctgggctatagccgggaagagattggcccgatcctggccagggtacggcaggaactgggg
aatgctgcccctacgacagccgtcctccaggcggtactaaaaacctttggccggggggga
ggggattaa

DBGET integrated database retrieval system