KEGG   Moorella thermoacetica: Moth_1738Help
Entry
Moth_1738         CDS       T00308                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mta  Moorella thermoacetica
Pathway
mta00010  Glycolysis / Gluconeogenesis
mta00030  Pentose phosphate pathway
mta00051  Fructose and mannose metabolism
mta00052  Galactose metabolism
mta00680  Methane metabolism
mta01100  Metabolic pathways
mta01110  Biosynthesis of secondary metabolites
mta01120  Microbial metabolism in diverse environments
mta01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Moth_1738
   00030 Pentose phosphate pathway
    Moth_1738
   00051 Fructose and mannose metabolism
    Moth_1738
   00052 Galactose metabolism
    Moth_1738
  Energy metabolism
   00680 Methane metabolism
    Moth_1738
Enzymes [BR:mta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Moth_1738
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Moth_1738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Arc
Motif
Other DBs
NCBI-GeneID: 3833038
NCBI-ProteinID: YP_430582
UniProt: Q2RHQ0
Position
complement(1788966..1790048)
Genome map
AA seq 360 aa AA seqDB search
MRKRLGILTGGGDCPGLNAVIRAATKTAMSHGYEMIGFLDGYTGVVEGRYIRLDPAAISG
LLHRGGTILGTNNRSNPFYFPIQENGETIYRDMSDLAIERLKEMNIEVLLVVGGDGTLAG
ARDFKAKGARVIGIPKTIDNDLAATDQTFGFDTAVRTATDALDKLHTTAESHHRVMVLEL
MGRYAGWIALYSGLAGGADVILIPEIPWNIESVLAKIEARRAEGKPFSIVVVAEGVKSPE
GELVVQRRVEGSVERVRLGGIGQLVGKLIEEKSGIETRVTVLGHIQRGGSPSSYDRVLAT
RFGVAAAELAVRGVHGVMVCLRGSDISHVPLEEAVGKPRTIPRDHQLLAAARAIGISFGE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcaaacgcctgggtattctcaccggcggcggcgactgccccggactcaatgccgtc
atcagggcggcgacgaagacggccatgagccacggctatgagatgatcggctttctggat
ggttataccggcgtcgttgaaggccggtatatcaggctggacccagcggctatttccggc
ctcctccaccggggaggcaccattctgggtaccaataaccgcagcaatcccttttatttt
cctatccaggaaaatggcgagaccatttaccgggatatgtcggacctggccatcgagcgc
cttaaggagatgaacatcgaggttctcctggtggttggcggtgatggcaccctggcgggg
gcccgggactttaaggccaaaggggcgcgagtcatcggcatccccaagaccatcgacaac
gacctggcggccaccgaccagaccttcggtttcgatacggccgtcaggacggccaccgac
gccctggataaattacataccacggcggaatcccatcaccgggtcatggtcctggagctt
atgggtcgttatgccggctggatcgccctgtacagcggcctggctggcggggcggatgta
atcttaattcctgagattccctggaatatagaaagcgtgctggctaaaatagaggcccgg
cgggccgagggtaagcccttcagcatagtcgttgttgccgaaggggtcaaatcgccggag
ggtgagctggtcgtccagcgccgggtggaaggtagcgtggaaagggtgcgcctgggtggc
atcggccagctggtgggtaaattgatagaagagaagagcggcatcgaaacccgggtgacg
gtcctgggccatatccagcggggcggctcgccttcctcctacgaccgcgttctggccact
cgcttcggggtggcggccgccgaactggccgtcaggggcgtccacggggtcatggtctgc
ctgcggggcagcgatatctcccatgtccccctggaagaagccgtcggcaagccccggacc
atcccaagggaccaccagctcctggccgcagccagggccattggaattagcttcggggag
tga

DBGET integrated database retrieval system