KEGG   Moorella thermoacetica: Moth_1776Help
Entry
Moth_1776         CDS       T00308                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mta  Moorella thermoacetica
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Moth_1776
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Moth_1776
   00650 Butanoate metabolism
    Moth_1776
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Moth_1776
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Moth_1776
   00622 Xylene degradation
    Moth_1776
   00621 Dioxin degradation
    Moth_1776
Enzymes [BR:mta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Moth_1776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1831432..1832307)
Genome map
AA seq 291 aa AA seqDB search
MDKVKVAVIGPGNIGSDLMYKILRSRHLEMALMTGIIESEGIKRARKLGIKTSIEGVKAV
LAEDDIKIVFDATGAKPHLQHAPLLKEAGKIAIDLTPAAVGPYVVPCVNLDQVKAEPNLN
MVTCGGQATVPIVYAINRVAGARYAEIVACIASKSAGPGTRQNIDEFTQTTAKALEVVGG
AKKGKAIIILNPAEPPIMMHNTIYVEVEKPDIEAIRASVEAMVKEIQSYVPGYRLVVPPI
LDGNKVTAAVEVEGAGDFLPKYSGNLDIITSAAVAVAEKLAQELQVKEGVA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtggacaaggtaaaagtggctgttatcggcccgggcaatatcgggtccgacctgatgtac
aagatcctgcgcagccggcatctagagatggccctgatgaccggtattatcgaatccgag
ggcatcaagcgggccaggaagctgggtatcaagacatccatcgaaggtgtcaaggccgtc
ctggcggaagacgatatcaagattgtctttgacgccaccggggccaaaccccacttacag
catgcgccgcttttaaaagaagcgggcaagatcgccatcgacttgacaccggcggcagta
ggtccctacgtggtaccctgtgtcaacctggaccaggttaaggccgaaccaaaccttaac
atggtcacctgcggtggccaggctacagtacccatcgtctatgccatcaaccgggtggcc
ggggccagatacgctgagattgtagcctgcatcgcttccaagagcgccgggccggggacc
cgccagaacattgacgagttcacccagactacggccaaggccctggaggttgtcggcggg
gcgaagaagggcaaagccatcattattctgaatcctgccgagccacccattatgatgcat
aacaccatttatgtagaggtcgaaaagcccgacatcgaagccattcgcgcttcggttgaa
gccatggtcaaggaaatccagagctatgttcccgggtaccggctcgtcgtgccgcccatt
cttgacggcaacaaagtaacggcagctgttgaagtggagggtgctggtgacttcctgccc
aaatactccggtaatctggatattatcacttcagcagccgtggcggtagctgaaaagctg
gcccaggaactgcaggtaaaggaaggggtagcatga

DBGET integrated database retrieval system