KEGG   Moorella thermoacetica: Moth_1815Help
Entry
Moth_1815         CDS       T00308                                 

Definition
(RefSeq) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
mta  Moorella thermoacetica
Pathway
mta00330  Arginine and proline metabolism
mta01100  Metabolic pathways
Module
mta_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Moth_1815
Enzymes [BR:mta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Moth_1815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 3830736
NCBI-ProteinID: YP_430658
UniProt: Q2RHH4
Position
complement(1874554..1875444)
Genome map
AA seq 296 aa AA seqDB search
MNNSAILEGFTRGQGFLASSDDFAGARAVLAGIPFDATTSFRPGTRWGPRAIRSVSEVLE
EYSPYLQRELTGVPFYDAGDLDLPPGRVEASLERMEAAADAIFAAARIPFFMGGEHLVSY
PLIRAAYRHYPDLAVLHFDAHADLREDYLGERFSHATVMRLVAEEIGPDRLYQFGIRSGT
WGEFAYGQEETNFFMDVITPPLAKLVPELVRRPLYVTIDIDVVDPAFAPGTGTPEPGGCP
PGEIFKAIQILQGANVVAFDLVEVCPAYDQSDITAILAAKILREAILAWGGKNDQA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaataactccgctatcttagaaggctttaccaggggccagggattcctggccagcagc
gacgattttgccggggcccgtgctgtcctggccggcattccctttgatgccaccaccagc
tttcgtcccggcacccgctggggcccccgggccatccgttccgtatcagaagtcctggag
gaatacagcccctacctgcagcgggagctgacgggagttcccttttacgacgcgggagac
ctcgacctcccgccgggcagggtggaggccagtttagaacgaatggaggcggcggccgac
gctatttttgccgccgccaggatcccattttttatggggggggagcacctggtgagctat
cccctcatccgggctgcctaccggcactatcccgatctggccgttctccatttcgacgcc
catgccgacctgcgggaggattacctgggggaaaggttctcccatgccaccgtcatgcgt
ctggtggcggaggagatcggccccgatcgcctctaccagtttggcatccggtccggtacc
tggggcgaattcgcctacggccaggaagaaaccaatttttttatggacgtgattaccccg
cccctggccaaactggtaccggaactggtccggcgccccttgtatgtgaccatagatatc
gacgtggtcgacccggcctttgcccccggtaccggtacccccgaaccggggggctgcccg
ccgggggagatctttaaagccatccagatcctgcagggggccaatgtagtcgcctttgac
ctggtggaggtctgcccggcctacgaccagagcgacattaccgccatcctggcggccaag
atcctccgcgaggccattctggcctggggagggaaaaacgaccaggcctga

DBGET integrated database retrieval system