KEGG   Moorella thermoacetica: Moth_1868Help
Entry
Moth_1868         CDS       T00308                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mta  Moorella thermoacetica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Moth_1868
   01230 Biosynthesis of amino acids
    Moth_1868
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Moth_1868
   00030 Pentose phosphate pathway
    Moth_1868
   00051 Fructose and mannose metabolism
    Moth_1868
   00052 Galactose metabolism
    Moth_1868
  Energy metabolism
   00680 Methane metabolism
    Moth_1868
Enzymes [BR:mta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Moth_1868
Protein phosphatases and associated proteins [BR:mta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Moth_1868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1931616..1932575)
Genome map
AA seq 319 aa AA seqDB search
MRTIGVLTSGGDAPGMNAAIRAVVRQAAALKIDVIGISRGYAGLIQGDFRRLNTGSVAGI
IHRGGTILLTARSEEFRTEAGRATALDNLHREGIEGLVVIGGDGSFHGAVHLAKKGLPVI
GIPGTIDNDIAGTDYTIGFDTAVNTAVEAISRIRDTATSHERIFIIEVMGRRSGQIALAA
GIAGGAESILIPEYPVNYDRVVEKLEQGRHRGKLHSIIVVAEGVGSALEVSEEIARRTRL
ESRVTILGHIQRGGAPTAFDCMLASRLGARAVDLLADGASSRMVGIAANELVDRDLETVL
REKKSIDPELYRLAEVLAL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcactatcggtgttttgaccagcggtggtgatgccccgggaatgaatgcagctatc
agggcggtagtccgccaggctgccgccctgaagatagacgtgatcggcatttcccggggg
tacgccgggttgatccagggcgattttcgccgcctgaataccggttcggtagccgggatt
atccaccggggcgggaccatcttgctgacggcccggtcggaggagttccgcaccgaagcc
ggccgggccacggccctggataacctgcaccgggaaggcattgaaggtctcgtagtcatc
ggtggagacgggtccttccacggcgctgttcacctggccaaaaagggcctgccggtaatc
ggcatccccgggaccattgataacgacatagccggcaccgattacaccatcggctttgat
acggccgttaatacggccgtagaggccatcagccggatccgggatacggcgacttcccat
gaacgcatttttatcatcgaagttatggggcgtcgctcaggccagattgccctggcggcg
gggatagccgggggcgccgaatctattctcatccccgagtaccccgttaactacgaccgg
gtggtggagaaattagaacagggccgccaccggggtaaactccatagtattatcgtcgta
gccgaaggggtgggcagtgccctggaggtaagcgaagaaatagcccggcgaaccaggctg
gagagccgcgtgaccatcctgggccatattcagcggggtggagcgcctacggcttttgat
tgtatgctggccagccggctgggcgcccgggcggtggacctcctggccgacggcgccagc
agccgcatggtgggcatcgccgccaacgagctggtggaccgggacctggagacggttctc
cgggaaaagaagagtatcgatcctgaactgtaccgtttagccgaagtactggcactataa

DBGET integrated database retrieval system