KEGG   Moorella thermoacetica: Moth_1868Help
Entry
Moth_1868         CDS       T00308                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mta  Moorella thermoacetica
Pathway
mta00010  Glycolysis / Gluconeogenesis
mta00030  Pentose phosphate pathway
mta00051  Fructose and mannose metabolism
mta00052  Galactose metabolism
mta00680  Methane metabolism
mta01100  Metabolic pathways
mta01110  Biosynthesis of secondary metabolites
mta01120  Microbial metabolism in diverse environments
mta01130  Biosynthesis of antibiotics
mta01200  Carbon metabolism
mta01230  Biosynthesis of amino acids
mta03018  RNA degradation
Module
mta_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Moth_1868
   00030 Pentose phosphate pathway
    Moth_1868
   00051 Fructose and mannose metabolism
    Moth_1868
   00052 Galactose metabolism
    Moth_1868
  Energy metabolism
   00680 Methane metabolism
    Moth_1868
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Moth_1868
Enzymes [BR:mta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Moth_1868
Protein phosphatases and associated proteins [BR:mta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Moth_1868
Messenger RNA biogenesis [BR:mta03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Moth_1868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_1 LpxK
Motif
Other DBs
NCBI-GeneID: 3831499
NCBI-ProteinID: YP_430711
UniProt: Q2RHC1
Position
complement(1931616..1932575)
Genome map
AA seq 319 aa AA seqDB search
MRTIGVLTSGGDAPGMNAAIRAVVRQAAALKIDVIGISRGYAGLIQGDFRRLNTGSVAGI
IHRGGTILLTARSEEFRTEAGRATALDNLHREGIEGLVVIGGDGSFHGAVHLAKKGLPVI
GIPGTIDNDIAGTDYTIGFDTAVNTAVEAISRIRDTATSHERIFIIEVMGRRSGQIALAA
GIAGGAESILIPEYPVNYDRVVEKLEQGRHRGKLHSIIVVAEGVGSALEVSEEIARRTRL
ESRVTILGHIQRGGAPTAFDCMLASRLGARAVDLLADGASSRMVGIAANELVDRDLETVL
REKKSIDPELYRLAEVLAL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcactatcggtgttttgaccagcggtggtgatgccccgggaatgaatgcagctatc
agggcggtagtccgccaggctgccgccctgaagatagacgtgatcggcatttcccggggg
tacgccgggttgatccagggcgattttcgccgcctgaataccggttcggtagccgggatt
atccaccggggcgggaccatcttgctgacggcccggtcggaggagttccgcaccgaagcc
ggccgggccacggccctggataacctgcaccgggaaggcattgaaggtctcgtagtcatc
ggtggagacgggtccttccacggcgctgttcacctggccaaaaagggcctgccggtaatc
ggcatccccgggaccattgataacgacatagccggcaccgattacaccatcggctttgat
acggccgttaatacggccgtagaggccatcagccggatccgggatacggcgacttcccat
gaacgcatttttatcatcgaagttatggggcgtcgctcaggccagattgccctggcggcg
gggatagccgggggcgccgaatctattctcatccccgagtaccccgttaactacgaccgg
gtggtggagaaattagaacagggccgccaccggggtaaactccatagtattatcgtcgta
gccgaaggggtgggcagtgccctggaggtaagcgaagaaatagcccggcgaaccaggctg
gagagccgcgtgaccatcctgggccatattcagcggggtggagcgcctacggcttttgat
tgtatgctggccagccggctgggcgcccgggcggtggacctcctggccgacggcgccagc
agccgcatggtgggcatcgccgccaacgagctggtggaccgggacctggagacggttctc
cgggaaaagaagagtatcgatcctgaactgtaccgtttagccgaagtactggcactataa

DBGET integrated database retrieval system