KEGG   Moorella thermoacetica: Moth_1922Help
Entry
Moth_1922         CDS       T00308                                 

Definition
(RefSeq) pyruvate ferredoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mta  Moorella thermoacetica
Pathway
mta00010  Glycolysis / Gluconeogenesis
mta00020  Citrate cycle (TCA cycle)
mta00620  Pyruvate metabolism
mta00633  Nitrotoluene degradation
mta00640  Propanoate metabolism
mta00650  Butanoate metabolism
mta00680  Methane metabolism
mta00720  Carbon fixation pathways in prokaryotes
mta01100  Metabolic pathways
mta01120  Microbial metabolism in diverse environments
mta01130  Biosynthesis of antibiotics
mta01200  Carbon metabolism
Module
mta_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Moth_1922
   00020 Citrate cycle (TCA cycle)
    Moth_1922
   00620 Pyruvate metabolism
    Moth_1922
   00640 Propanoate metabolism
    Moth_1922
   00650 Butanoate metabolism
    Moth_1922
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Moth_1922
   00680 Methane metabolism
    Moth_1922
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Moth_1922
Enzymes [BR:mta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Moth_1922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-GeneID: 3830846
NCBI-ProteinID: YP_430765
UniProt: Q2RH67
Position
complement(1994326..1995501)
Genome map
AA seq 391 aa AA seqDB search
MRVYLNGNEAVATAVRLARAEVVAAYPITPQSTIVEKIAEYIANGSMAADYIRVESEHAA
LAACYGAAVTGTRVFTATSSQGLAYMFEMLHYVSGCRVPLVMAVANRGLAAPWTIWADHQ
DAIACRDTGWIQLYVETAQEALDTCLQAYKIAAHPEVLTPVMVCLDGYVLSHTEEIVDVP
EQEAVDGFLPPYRPEYAVDTARPMVFGIGAGPELYPAFKYYQHQAMLRAQEVIEDVDGEF
AALFGRSYGGLVDPYYCDEAEVILVLMGATAGTAREVVDDLRRQGEPVGFLRLRSFRPFP
IAALRAALAGTRVVAVLDRDCSFGYEGVLATEVKAALQGVPGAPVVAGFTGGLGGRDIRP
EDLAGIFRHCLEAVRHRNRGEGLVVSGGWQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtctacttgaacggtaatgaagcggtggcgactgccgtccggcttgccagggcg
gaagtggtggccgcttatcccatcactccccagtcgactattgtcgagaagatcgctgaa
tatattgccaacgggtccatggcggccgactacatacgagtggaatcggaacacgccgcc
ctggcggcctgctacggcgccgccgtgacgggcacccgggtttttaccgccacttcctcc
caggggctggcctatatgtttgaaatgctacattacgtcagcggctgtcgggtgcccctg
gtcatggccgtggccaaccgcggcctggcggcgccgtggaccatctgggccgatcaccag
gatgccatagcctgccgcgacacgggctggatccagctctatgtggaaactgcccaggaa
gccctggatacctgcctccaggcttataagatagcagcccacccggaggtgctgactccg
gtcatggtctgcctggacggttatgtcctatcccatacggaagaaatagtagacgtgccg
gagcaggaggcggtcgacggtttcttgccgccataccggccggaatatgccgttgacacc
gcaaggcccatggtttttggcatcggcgccgggccggagctttaccctgcctttaaatac
taccagcatcaggccatgctccgggcccaggaggtaatagaagatgtcgacggagagttc
gccgccctgttcgggcgcagttacggcggcctggtagacccctattattgcgacgaggca
gaagtgatcctggtattgatgggtgccaccgccggcacggcccgggaagtggtcgacgat
ctgcgccgccagggggaaccggtgggatttttacgcctgcggagtttccggcccttcccg
atagcagccctccgggcggccctggcggggaccagggtggtggccgttctggaccgggac
tgctccttcggttacgaaggagtgctggctacggaggtcaaggccgccctccagggcgta
cccggagcaccggtggtggctggctttaccggcggtctggggggccgcgatattcgccct
gaggatctggccggcattttccgccactgtctggaggctgtccggcatcggaacaggggc
gaaggattggttgtcagcggcggctggcagaagtaa

DBGET integrated database retrieval system