KEGG   Moorella thermoacetica: Moth_1998Help
Entry
Moth_1998         CDS       T00308                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mta  Moorella thermoacetica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Moth_1998
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Moth_1998
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Moth_1998
Enzymes [BR:mta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Moth_1998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2082267..2083511)
Genome map
AA seq 414 aa AA seqDB search
MSNITQLRCINCSRTYQPRPGFYTCPICGSTDGILDVEYDYDYINKSISRQSLASNREHS
LWRYRPFLPVAQEGPLPPLRVGWSPLYRARRLGDELGLKELYIKDDGINPTGSLKDRPSA
VAVARALAEGAKVVACSSTGNAASSLAGAAASVGLKAVIFVPGRAPQGKVAQLLIFGATV
ISVQGSYEDAFKLSAAAIAEHGWYNRNAAINPYLVEGKKTVCLEVAEQLNWEVPDWVVLS
VGDGCTMAGAWKAWVDLKKAGWIDKLPRMLGVQAEGCCPITRAFREGTRVKPMPENTLAD
SIAVGVPRNPEKALRAVRDSGGTMINVSDEEILAAMRTLGRTSGIFGEPAGAAGTAGLIK
AVQEGIIKSGDKVVVLVTGNGLKDVANAIKAAGEPIRVEPSLEALKEALARYGK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatataacccaactacgctgtataaactgcagccgtacctatcaaccccggccc
ggcttttatacctgccccatctgcgggtcgacggacggcatcctggatgtcgaatacgat
tacgattatataaacaaatccatctccaggcagagcctggccagcaaccgggaacattcc
ctctggcgttaccgtcccttcttgccggtggcccaggagggaccgctgccccctctgcgg
gtgggttggagccccctgtaccgggcccggcgcctgggggacgaactggggttgaaagag
ctatatatcaaggacgatgggattaatcccacggggtctttaaaagacaggccttcggcc
gtggcggtggcccgagccctggccgaaggagctaaggtggtcgcctgctcttcaaccggc
aacgctgcttcctccctggcgggggcagcagcttccgtgggcctgaaggcggtaatcttt
gtaccgggacgggcaccgcaagggaaggtagcccaactcttgattttcggggccaccgtt
atcagtgttcagggatcctatgaggatgccttcaagctttcggcggcggccatagccgag
cacggctggtacaaccgcaatgccgccattaacccttatctggtagaaggcaaaaagaca
gtttgcctggaagtggcggaacagctaaactgggaggtacccgactgggtggtcctttcc
gtgggcgacggttgtaccatggccggtgcctggaaggcctgggtggacctgaaaaaggcc
ggttggattgacaaactgccgcggatgctgggggtccaggccgagggttgctgccccatt
accagggccttccgggagggaaccagggtaaaacccatgcccgaaaataccctggcggac
agcatcgccgtcggcgtgccccgcaatccagaaaaggctctgcgggccgtaagggattcc
gggggtacgatgatcaacgtcagcgatgaagaaatccttgcagccatgcgcaccctgggg
cggaccagcggcatcttcggcgaacctgccggtgcagccgggaccgccggccttatcaaa
gccgtccaggaaggaataattaaatccggagataaggtggtcgtcctggtaacaggcaac
ggcctcaaggatgtggccaatgccatcaaagcggccggagagcctatccgggtggagccc
tccctggaggccttaaaggaagccctggctcggtacgggaaatga

DBGET integrated database retrieval system