KEGG   Moorella thermoacetica: Moth_2170Help
Entry
Moth_2170         CDS       T00308                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mta  Moorella thermoacetica
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Moth_2170
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Moth_2170
   00620 Pyruvate metabolism
    Moth_2170
   00640 Propanoate metabolism
    Moth_2170
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Moth_2170
   00680 Methane metabolism
    Moth_2170
Enzymes [BR:mta01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Moth_2170
Lipid biosynthesis proteins [BR:mta01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Moth_2170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2270578..2271567
Genome map
AA seq 329 aa AA seqDB search
MGKDARTIEALLKENRSFPPPPAFAAAANARDNDLYREGESAEEFWGREAARLHWFRRWD
RVLEWDYPLAWWFNGGTLNASYNCLDRHVETWRRNKAAIIWEGEPGDAVVLTYRDLYREV
NKFAAVLRSLWVKRDDRVAIYLPMIPELPIAMLACARIGAVHNVVFGGFSAAALRDRIND
TGAKILITADGGFRKGRIVGLKESADTALDGAPSIERVIVAKRTGERVNMHPGRDLWWHE
LMAAAPLYTPPEHMEAEDPLFILHTSGTSGKPKGVVHTTGGYLVGTATTSHTPMRPETEP
PGNPGGFYARLTKRPLRCSMKLQRLGFSF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagacgcccggaccattgaagctttattaaaggaaaaccgttccttcccgccc
ccgccggcctttgcggcggcggccaacgccagggataacgacctctaccgggaaggtgaa
agtgcggaagaattctggggccgggaggccgccaggctccactggttccgccgctgggac
cgggtgctggaatgggattaccccctggcctggtggttcaacggcggtaccctaaatgcc
tcatataactgcctggaccggcatgtagagacctggcgccggaacaaggctgccattatc
tgggaaggggaacccggggatgctgtagtccttacctaccgcgacctctaccgggaggta
aacaagtttgcagccgtcctgcgctccctgtgggttaaacgggacgaccgggttgccatc
tatttacccatgatcccggaactacccatcgccatgctggcttgcgcccgcatcggcgcc
gtccataacgtggtcttcggcggcttcagtgccgccgccctgcgggatcggatcaatgat
actggcgccaaaatactcattaccgccgatggggggttccgtaaaggccggatagttgga
ttaaaggagagcgccgataccgccctggacggagcccccagtatcgagcgggtcattgtc
gccaagcgtaccggcgaaagggtaaatatgcatccgggccgggacctctggtggcacgaa
ctcatggccgcggctcccctgtacactccgccggaacacatggaggctgaggaccccctc
tttatcctccataccagcggcaccagcggcaaacccaaaggtgtggtccataccacgggc
ggctatctggtaggtacagccaccacttcccatacgccgatgaggcctgaaaccgaacct
cccggtaacccgggaggtttttatgcccgattgacaaaaaggccgcttcggtgtagcatg
aaattacaaaggttaggattttctttctaa

DBGET integrated database retrieval system