KEGG   Moorella thermoacetica: Moth_2170Help
Entry
Moth_2170         CDS       T00308                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mta  Moorella thermoacetica
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Moth_2170
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Moth_2170
   00620 Pyruvate metabolism
    Moth_2170
   00640 Propanoate metabolism
    Moth_2170
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Moth_2170
   00680 Methane metabolism
    Moth_2170
Enzymes [BR:mta01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Moth_2170
Lipid biosynthesis proteins [BR:mta01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Moth_2170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2270578..2271567
Genome map
AA seq 329 aa AA seqDB search
MGKDARTIEALLKENRSFPPPPAFAAAANARDNDLYREGESAEEFWGREAARLHWFRRWD
RVLEWDYPLAWWFNGGTLNASYNCLDRHVETWRRNKAAIIWEGEPGDAVVLTYRDLYREV
NKFAAVLRSLWVKRDDRVAIYLPMIPELPIAMLACARIGAVHNVVFGGFSAAALRDRIND
TGAKILITADGGFRKGRIVGLKESADTALDGAPSIERVIVAKRTGERVNMHPGRDLWWHE
LMAAAPLYTPPEHMEAEDPLFILHTSGTSGKPKGVVHTTGGYLVGTATTSHTPMRPETEP
PGNPGGFYARLTKRPLRCSMKLQRLGFSF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagacgcccggaccattgaagctttattaaaggaaaaccgttccttcccgccc
ccgccggcctttgcggcggcggccaacgccagggataacgacctctaccgggaaggtgaa
agtgcggaagaattctggggccgggaggccgccaggctccactggttccgccgctgggac
cgggtgctggaatgggattaccccctggcctggtggttcaacggcggtaccctaaatgcc
tcatataactgcctggaccggcatgtagagacctggcgccggaacaaggctgccattatc
tgggaaggggaacccggggatgctgtagtccttacctaccgcgacctctaccgggaggta
aacaagtttgcagccgtcctgcgctccctgtgggttaaacgggacgaccgggttgccatc
tatttacccatgatcccggaactacccatcgccatgctggcttgcgcccgcatcggcgcc
gtccataacgtggtcttcggcggcttcagtgccgccgccctgcgggatcggatcaatgat
actggcgccaaaatactcattaccgccgatggggggttccgtaaaggccggatagttgga
ttaaaggagagcgccgataccgccctggacggagcccccagtatcgagcgggtcattgtc
gccaagcgtaccggcgaaagggtaaatatgcatccgggccgggacctctggtggcacgaa
ctcatggccgcggctcccctgtacactccgccggaacacatggaggctgaggaccccctc
tttatcctccataccagcggcaccagcggcaaacccaaaggtgtggtccataccacgggc
ggctatctggtaggtacagccaccacttcccatacgccgatgaggcctgaaaccgaacct
cccggtaacccgggaggtttttatgcccgattgacaaaaaggccgcttcggtgtagcatg
aaattacaaaggttaggattttctttctaa

DBGET integrated database retrieval system