KEGG   Moorella thermoacetica: Moth_2266Help
Entry
Moth_2266         CDS       T00308                                 

Definition
D-fructose 1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mta  Moorella thermoacetica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Moth_2266
   01230 Biosynthesis of amino acids
    Moth_2266
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Moth_2266
   00030 Pentose phosphate pathway
    Moth_2266
   00051 Fructose and mannose metabolism
    Moth_2266
  Energy metabolism
   00680 Methane metabolism
    Moth_2266
Enzymes [BR:mta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Moth_2266
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Moth_2266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2372373..2373512)
Genome map
AA seq 379 aa AA seqDB search
MGERITLSVIKADIGGFVGHSSVHPRLLETAERYLAESKLLIDYRVAHVGDDIDLIMTHK
YGVDCPEIHHLAWNVFLQCTEVARELKLYGAGQDLLSDAFSGNVKGMGPGVAEMEFEERK
SEPIIVFAADKTEPGAWNLPLYKMFADPFNTIGLVIDPKMHQGFRFEVYDLIKNERVEFS
LPEELYDLLVFIGAPGRYCIKSVYSKTTGEIAAVSSTQRLNLMAGRYVGKDDPVCIVRCQ
SGLPAVGEALEPFANPHLVAGWMRGSHIGPLMPVGLDQSAPTRFDGPPRVVAMGFQLSGG
RLVGPQDFFGDVAFDKARQTANEIASYLRSLGPFEPHRLPLEDMEYTTMPEVMAKLKNRF
VKVDHRDDREPAAEELGAK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ttgggtgaaaggattacattaagtgtcattaaggcagacattggcggctttgtgggccac
tccagcgtccacccgcggctgctggagacagcggaacgttacctggcagaaagcaagctc
ctcattgattaccgggtggcccacgttggtgacgatattgaccttattatgactcataag
tatggcgttgattgcccggaaattcatcatctggcctggaatgtttttctccagtgtacc
gaggtggcccgggaactaaagctttacggcgccggccaggacctgctgtcggatgctttc
tccggtaatgtcaagggcatgggtcccggggtcgcggaaatggagtttgaagaacgcaag
agcgaacctataatcgtttttgctgccgataaaaccgaacccggcgcctggaaccttccc
ctttataaaatgtttgccgaccccttcaatactatcggcctggtcatcgatcccaagatg
caccagggattccgtttcgaggtctatgacctgataaaaaacgagcgggtagagttctcc
ctgccggaggagctctatgatctcctggtcttcatcggcgctccggggcgttactgcatc
aagtctgtttactcgaagacaaccggcgagattgcagccgtttccagtacccaacgcctg
aacctcatggccgggcgctatgtcgggaaggacgatccggtctgcattgtccgttgccag
agcggtctgccggctgtaggtgaggccctggagcccttcgctaatccccacctggtagcc
ggctggatgcggggttctcatatcggccccctgatgccggtaggcctcgatcagtcggca
ccgacacgctttgacgggccgccgcgggtggtagccatgggcttccagctgtccggcggg
cgattggtagggccccaggacttcttcggcgacgtggcttttgataaggcccgccagacg
gctaacgagattgccagctacctgcgttccctgggtccattcgaaccccaccgcctgccc
ctggaggacatggaatacaccaccatgcccgaggtcatggccaaactgaagaaccgtttt
gtaaaggtcgaccatcgggacgaccgggaaccggcagccgaagaattgggagccaaatag

DBGET integrated database retrieval system