KEGG   Moorella thermoacetica: Moth_2275Help
Entry
Moth_2275         CDS       T00308                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mta  Moorella thermoacetica
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Moth_2275
Enzymes [BR:mta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Moth_2275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2382738..2384045)
Genome map
AA seq 435 aa AA seqDB search
MQMLDLIRRKREGQALAPAEIEAMIRDYTAGIIPDYQMAAFLMAVYFRGLDREETAALTR
AMIASGEQIEWSSIPGVKVDKHSTGGVADTTTLVLAPLVAAAGVPVVKMSGRGLGHTGGT
IDKLESIPGFRVQLTREEMIRQVKEIGLAVTAPTGKLAPADGKLYALRDVTATVESIPLI
ASSVMSKKIAAGADAIVLDVKVGSGAFMPDLESARELARIMVDLGREMGRRVVAVITNMD
EPLGMMVGNALEVGEAIAVLSGGGPRELREVCLTLGSQMLLLAGATGSDGEARRRLEELL
AGGAALAKFRRFIAAQGGDPAVVDRPELLPRATDQVTIAALSSGYISAVQARLVGEAAML
LGAGRITKESPIDLAVGIELKKRLGDYVNAGEPLAVFHVNDRANLEAARERFLAAYILAA
APPTPQPLVYEIIRG
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgcttgacttaatccgtcgcaagcgggagggccaggccctggccccagccgaa
attgaggccatgatacgggattatacggccgggataatccccgactatcagatggcagcc
tttctcatggccgtctattttcgcggcctggaccgggaggaaacggcggccctcaccagg
gccatgatagcctcgggggaacagattgagtggagttccatcccgggggtgaaggtcgac
aagcacagtaccggaggtgtggccgacaccaccaccttggtcctggcgcccctggtggcc
gccgccggagtgccggtagttaagatgtccggccgcggcctgggacacactgggggcact
attgacaaactggaatccatccccggcttcagggtgcagctgacgcgggaagagatgatt
cgccaggtaaaggagatcggcctggccgtcactgctcccacggggaagctggccccggct
gacggcaagctctacgccctgcgggacgtcacagcgactgttgagagcatacccctcatt
gccagcagtgtaatgagcaaaaagatcgccgctggcgccgacgccatagtcctcgatgtc
aaggttggcagcggcgcctttatgcccgacctggagtcggcccgggaactggcccggatc
atggtggatctgggccgggagatggggcggcgggtggtagctgtgattaccaatatggac
gaacccctggggatgatggtgggcaacgccctggaagtcggggaggccatcgccgtttta
tccggcggcgggccgcgggagttgcgggaggtttgcctcaccctgggcagccagatgctt
ctactggccggggctaccggtagtgacggtgaggcgcgccggcgtctggaggagctcctg
gccggtggcgccgccctggccaaattccggcggttcattgccgcccagggcggcgacccg
gcggtagtcgaccggccggaacttctcccccgcgccacggatcaggttaccattgccgcc
ctaagcagcggctacatcagcgccgtccaggcacgcctggtgggcgaggcggctatgctc
ctgggggccgggcgaataaccaaagaaagccccatcgacctggcggttggtatcgaacta
aaaaaacgtctgggagattatgttaacgccggcgagcccctggctgtattccacgtcaac
gaccgggccaacctggaggcagcccgggagagattcctggcggcctatattctggccgcc
gcaccgcccaccccgcaacccctggtgtatgagataatcaggggataa

DBGET integrated database retrieval system