KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_00492Help
Entry
TBMG_00492        CDS       T00940                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TBMG_00492 (gpmA)
   01230 Biosynthesis of amino acids
    TBMG_00492 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TBMG_00492 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    TBMG_00492 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TBMG_00492 (gpmA)
Enzymes [BR:mtb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TBMG_00492 (gpmA)
Exosome [BR:mtb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TBMG_00492 (gpmA)
  Exosomal proteins of melanoma cells
   TBMG_00492 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
578608..579378
Genome map
AA seq 256 aa AA seqDB search
MRERLAGMANTGSLVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLP
DVLYTSLLRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQF
MAWRRSYDTPPPPIERGSQFSQDADPRYADIGGGPLTECLADVVARFLPYFTDVIVGDLR
VGKTVLIVAHGNSLRALVKHLDQMSDDEIVGLNIPTGIPLRYDLDSAMRPLVRGGTYLDP
EAAAAGAAAVAGQGRG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgagagacttgccggtatggcaaacactggcagcctggtgttgctgcgccacggc
gagagcgactggaatgccctcaacctgttcaccggctgggtcgatgtcggcctgacggac
aagggccaggcagaggcggttcgaagcggcgagctgatcgcggaacacgacctattgccc
gacgtgctctacacctcgttgctgcggcgcgcgatcaccaccgcgcatctggcgttggac
agcgccgatcggctctggattcccgtgcggcgtagctggcggctcaacgaacgccactac
ggcgcgctgcagggtttggacaaggccgagaccaaggcccgctatggcgaagagcagttc
atggcctggcggcgcagctatgacacgccgccgccgccgatcgagcggggcagtcagttc
agccaggacgccgaccctcgttacgccgacatcggcggtggcccgctcaccgaatgtctg
gctgacgtggtcgcccggtttttgccatatttcaccgacgtcatcgttggcgacttgcgg
gtcggcaagacggtgctgatcgttgcccacggcaactcgttgcgcgcgctggtcaagcac
ctggaccagatgtctgacgacgaaatcgtcggactgaacatcccgaccggaattccgctg
cgctacgacctggattccgcgatgaggccgctggtgcgcggtggtacgtatctggacccg
gaggcggcagccgccggcgccgccgcggtggccggccagggccgcgggtaa

DBGET integrated database retrieval system