KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_00937Help
Entry
TBMG_00937        CDS       T00940                                 

Definition
transferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mtb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TBMG_00937
Enzymes [BR:mtb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     TBMG_00937
Glycosyltransferases [BR:mtb01003]
 Polysaccharide
  Storage polysaccharide
   TBMG_00937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1020962..1022230)
Genome map
AA seq 422 aa AA seqDB search
MVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRCPSGTDPSTHPSSDEVTEGVRVI
AAAQDPHEFTFGNDMMAWTLAMGHAMIRAGLRLKKLGTDRSWRPDVVHAHDWLVAHPAIA
LAQFYDVPMVSTIHATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSASMNDEITE
LFGPGLAEITVIRNGIDAARWPFAARRPRTGPAELLYVGRLEYEKGVHDAIAALPRLRRT
HPGTTLTIAGEGTQQDWLIDQARKHRVLRATRFVGHLDHTELLALLHRADAAVLPSHYEP
FGLVALEAAAAGTPLVTSNIGGLGEAVINGQTGVSCAPRDVAGLAAAVRSVLDDPAAAQR
RARAARQRLTSDFDWQTVATRPRRCTWRRSAVNGSRSPGCPSSSTLFPIGSRGRDVMIGA
PQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgtgggagtacccgccggtggtgatcggcggactcggccgccacgtgcatcat
ctgtcgaccgcgctagccgcagccggtcacgatgtcgtcgtgttgtcccggtgtccgtcg
ggcaccgatcccagcacacacccatcctccgatgaggtgaccgaaggggtccgggtgatt
gcggccgcgcaggacccgcacgagttcacgtttggcaacgacatgatggcctggaccctg
gcgatgggccacgccatgatccgcgccgggctgcgcttgaagaaacttggcaccgaccgc
tcgtggcgtcctgacgtcgtgcacgcacacgactggctggtggcccatccggccatcgcc
cttgcccagttctatgacgtgccaatggtttccacgattcatgcaacggaggccggtcga
cattccggctgggtctccggagctctcagccgtcaggtgcacgcggtcgagtcgtggctg
gtgcgtgaatccgattcgctgatcacatgctcggcgtcgatgaacgacgagatcaccgag
ctgttcgggcccgggctggccgagatcaccgtgatccgtaacggcattgacgcggcgcgc
tggccgttcgcggcccgccgcccgcgcaccgggccagccgaattgctctatgtggggcgg
ctggagtacgagaagggcgtgcacgacgccatcgccgcgctgccgcggctcaggcgcact
cacccaggcaccacactgaccatcgccggcgaaggcacccagcaggattggttgatcgat
caggcccgcaaacaccgggtgctcagagcaaccaggttcgtcggacacctcgaccacacc
gagctgctggcgttgctgcaccgagccgacgccgcggtgctgcccagccactacgaaccg
tttgggctggtggcactggaggccgccgcggccggcaccccgctggtgacgtccaacatc
ggcggtctgggtgaagcggtcatcaatggacagaccggggtgtcgtgtgcaccccgcgac
gtagcggggctggccgccgcggtgcgtagcgtgctcgacgatccggccgccgcgcagcgg
cgcgcacgagccgcccggcaacggctcacctccgacttcgactggcagacggtggccacg
cgaccgcgcaggtgtacctggcggcgaagcgcggtgaacggcagccgcagccccggttgc
ccatcgtcgagcacgctcttcccgatcggtagccgtggcagggacgtgatgatcggagca
ccgcagtga

DBGET integrated database retrieval system