KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_01047Help
Entry
TBMG_01047        CDS       T00940                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mtb03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1174135..1175004
Genome map
AA seq 289 aa AA seqDB search
MPELPEVEVVRRGLQAHVTGRTITEVRVHHPRAVRRHDAGPADLTARLRGARINGTDRRG
KYLWLTLNTAGVHRPTDTALVVHLGMSGQMLLGAVPCAAHVRISALLDDGTVLSFADQRT
FGGWLLADLVTVDGSVVPVPVAHLARDPLDPRFDCDAVVKVLRRKHSELKRQLLDQRVVS
GIGNIYADEALWRAKVNGAHVAATLRCRRLGAVLHAAADVMREALAKGGTSFDSLYVNVN
GESGYFERSLDAYGRDGENCRRCGAVIRRERFMNRSSFYCPRCQPRPRK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctgcccgaagtcgaggtggtgcggcgcggcttgcaggctcacgtgaccggc
cggaccatcaccgaggttcgggtgcaccacccccgcgctgtgcgccgccacgatgccggg
cccgcggatctgacggcgcggctgcggggagcgcggatcaacggaaccgatcggcgcggc
aagtacctgtggttgacactcaatacggctggggtccataggccgacggacaccgcactc
gtggtgcacctgggcatgagtgggcagatgctgctcggggcggtgccgtgtgccgctcac
gtccggatttccgcgctgctcgacgacgggaccgtgctgagcttcgctgaccaacggacc
ttcggagggtggctgcttgccgacctggtgacggtggacggcagcgtggtaccggtgccg
gtcgcccacctggcgcgcgacccgcttgacccgcggttcgattgtgacgctgtagttaaa
gtgttgcggcgcaagcattccgaactcaagcgccagctgctggatcagcgggtggtgtcg
ggaatcggcaacatctatgccgatgaggcgctgtggcgggccaaggtgaacggcgcccac
gtcgccgccacactaaggtgccggcgtctgggagcggtcctgcatgccgccgccgacgtg
atgcgcgaagcgctggcgaaaggtggcacctcgttcgactctttgtatgtcaacgtcaac
ggcgagtcgggctacttcgagcggtcgctggacgcttatggccgcgacggcgaaaactgt
cggcgctgcggcgcggtgatacgccgggagaggtttatgaaccgctcgtcgttctactgc
ccgcgatgccagccgcggccccgaaagtag

DBGET integrated database retrieval system