KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_01294Help
Entry
TBMG_01294        CDS       T00940                                 

Definition
(GenBank) enoyl-CoA hydratase echA15
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
mtb00071  Fatty acid degradation
mtb00280  Valine, leucine and isoleucine degradation
mtb00281  Geraniol degradation
mtb00310  Lysine degradation
mtb00360  Phenylalanine metabolism
mtb00362  Benzoate degradation
mtb00380  Tryptophan metabolism
mtb00410  beta-Alanine metabolism
mtb00627  Aminobenzoate degradation
mtb00640  Propanoate metabolism
mtb00650  Butanoate metabolism
mtb00903  Limonene and pinene degradation
mtb00930  Caprolactam degradation
mtb01100  Metabolic pathways
mtb01110  Biosynthesis of secondary metabolites
mtb01120  Microbial metabolism in diverse environments
mtb01130  Biosynthesis of antibiotics
mtb01212  Fatty acid metabolism
Module
mtb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mtb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TBMG_01294
   00650 Butanoate metabolism
    TBMG_01294
  Lipid metabolism
   00071 Fatty acid degradation
    TBMG_01294
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TBMG_01294
   00310 Lysine degradation
    TBMG_01294
   00360 Phenylalanine metabolism
    TBMG_01294
   00380 Tryptophan metabolism
    TBMG_01294
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TBMG_01294
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    TBMG_01294
   00281 Geraniol degradation
    TBMG_01294
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TBMG_01294
   00627 Aminobenzoate degradation
    TBMG_01294
   00930 Caprolactam degradation
    TBMG_01294
Enzymes [BR:mtb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     TBMG_01294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACT24345
Position
complement(1419173..1420003)
Genome map
AA seq 276 aa AA seqDB search
MPVTYDDFPSLRCEIHDQPGHEGVLELVLDSPGLNSVGPHMHRDLADIWPVIDRDPAVRV
VLVRGEGKAFSSGGSFDLIAETIGDYQGRLRIMREARDLVLNLVNFDKPVVSAIRGPAVG
AGLVVALLADISVAGRAAKIIDGHTKLGVAAGDHAAICWPLLVGMAKAKYYLLTCEPLSG
EEAERIGLVSICVDDDDVLPTATRLAERLAAGAQNAIRWTKRSLNHWYRMFGPAFETSLG
LEFIGFGGPDVREGLAAHREKRPARFGADPDPGAGS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgccagttacctacgacgacttccccagcctgcgctgcgaaatccacgaccaacctggt
cacgaaggcgtgctggagctggtgctggactcccccgggctgaactcggtcgggccgcac
atgcaccgcgaccttgccgacatctggccggtgatcgatcgcgacccggccgtgcgcgtg
gtcttggtccgcggtgaaggcaaggccttttcctccggcggcagtttcgacctgatcgcc
gaaaccatcggcgactaccagggccggctgcgcatcatgcgcgaggcccgcgacctggtg
ctcaacctggtcaacttcgacaagccggtggtgtcggcgattcggggcccggccgtcggt
gcgggtctggttgtcgcgctgctcgccgacatttcggtggcgggccgcgccgcgaagatc
atcgatgggcacaccaaactcggggtcgccgcgggggatcacgcggcgatctgctggccc
ctgctggtcggcatggccaaggccaagtactacctgctgacctgcgagccgctgtccggg
gaggaggccgaacgcatcggtctggtctccatctgcgtcgacgacgacgatgtgctcccc
accgcaacacgcctggcggagcggctcgccgctggcgcgcaaaacgccatccgctggacc
aaacgcagcctcaatcactggtatcgcatgttcggtcccgccttcgaaacgtcgctcggg
ctggagttcatcgggttcggtggtcccgacgtccgggaaggcctggccgcgcaccgcgaa
aagcgccccgcgcggttcggcgccgaccccgatcccggcgccggcagctga

DBGET integrated database retrieval system