KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_01533Help
Entry
TBMG_01533        CDS       T00940                                 

Definition
(GenBank) glutamate 5-kinase proB
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
mtb00330  Arginine and proline metabolism
mtb00332  Carbapenem biosynthesis
mtb01100  Metabolic pathways
mtb01130  Biosynthesis of antibiotics
mtb01230  Biosynthesis of amino acids
Module
mtb_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mtb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TBMG_01533
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    TBMG_01533
Enzymes [BR:mtb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TBMG_01533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACT24587
Position
1675432..1676562
Genome map
AA seq 376 aa AA seqDB search
MRSPHRDAIRTARGLVVKVGTTALTTPSGMFDAGRLAGLAEAVERRMKAGSDVVIVSSGA
IAAGIEPLGLSRRPKDLATKQAAASVGQVALVNSWSAAFARYGRTVGQVLLTAHDISMRV
QHTNAQRTLDRLRALHAVAIVNENDTVATNEIRFGDNDRLSALVAHLVGADALVLLSDID
GLYDCDPRKTADATFIPEVSGPADLDGVVAGRSSHLGTGGMASKVAAALLAADAGVPVLL
APAADAATALADASVGTVFAARPARLSARRFWVRYAAEATGALTLDAGAVRAVVRQRRSL
LAAGITAVSGRFCGGDVVELRAPDAAMVARGVVAYDASELATMVGRSTSELPGELRRPVV
HADDLVAVSAKQAKQV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtccgcatcgggacgcaatccggaccgcgcgcggccttgtcgtgaaggtcggg
accacggcgcttaccacaccgtccgggatgttcgatgccggccggctggccggactggcc
gaggcggtcgagcggcggatgaaggcgggttccgacgtcgtcatcgtgtcttcgggcgcc
atcgccgccggcatcgagccgctcgggctgtcccgtcgtcccaaagatctggcgaccaag
caggcggcggccagcgtcgggcaggtcgcgctggtgaactcgtggagcgcggcgttcgcc
cgctacggccgcacggtgggccaggtgctgctgaccgcgcacgacatttcgatgcgggtg
cagcacaccaacgcccaacgcacgctggatcggctgcgcgcgttgcacgcggtggcgatt
gtcaacgagaacgacaccgtggccaccaacgagatccggttcggtgacaacgatcggctg
tctgcactggtggcgcacctggtcggcgccgacgctttggtgctgctgtcggacatcgac
ggcctctacgactgcgacccgcgcaaaaccgcggacgcgacgttcattccggaggtgtcc
gggccggcggatctggacggtgtggtcgccggccgcagtagccacctgggtactggcggc
atggcgtccaaggtggcggcggcgctgttggccgccgacgccggggtgccggtactgctg
gcccccgcggccgacgccgcgaccgcgctcgccgacgcgtcggtgggcacggtgtttgcg
gcccggcccgcgcgtctgtcggcccggcggttctgggtgcgttatgccgccgaagcaacc
ggcgcactgactctcgacgccggtgcggtgcgcgctgtggtgcgacaacgccggtcactg
ctggcggcgggtatcaccgcggtgtccggccggttttgcggcggcgatgtggtcgaactg
cgtgcacccgacgcggccatggtagcccgcggggtggttgcctacgacgcgtccgagctg
gccaccatggtgggccggtccacctctgagctacccggcgagctgcgccgcccggtggtg
cacgccgacgatctggtcgcggtgtcggcgaagcaagctaagcaagtttag

DBGET integrated database retrieval system