KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_01938Help
Entry
TBMG_01938        CDS       T00940                                 

Definition
pyrazinamidase/nicotinamidas pncA
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    TBMG_01938
Enzymes [BR:mtb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     TBMG_01938
    3.5.1.-  
     TBMG_01938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2127473..2128033
Genome map
AA seq 186 aa AA seqDB search
MRALIIVDVQNDFCEGGSLAVTGGAALARAISDYLAEAADYHHVVATKDFHIDPGDHFSG
TPDYSSSWPPHCVSGTPGADFHPSLDTSAIEAVFYKGAYTGAYSGFEGVDENGTPLLNWL
RQRGVDEVDVVAIATDHCVRQTAEDAVRNGLATRVLVDLTAGVSADTTVAALEEMRTASV
ELVCSS
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgttgatcatcgtcgacgtgcagaacgacttctgcgagggtggctcgctggcg
gtaaccggtggcgccgcgctggcccgcgccatcagcgactacctggccgaagcggcggac
taccatcacgtcgtggcaaccaaggacttccacatcgacccgggtgaccacttctccggc
acaccggactattcctcgtcgtggccaccgcattgcgtcagcggtactcccggcgcggac
ttccatcccagtctggacacgtcggcaatcgaggcggtgttctacaagggtgcctacacc
ggagcgtacagcggcttcgaaggagtcgacgagaacggcacgccactgctgaattggctg
cggcaacgcggcgtcgatgaggtcgatgtggtcgctattgccaccgatcattgtgtgcgc
cagacggccgaggacgcggtacgcaatggcttggccaccagggtgctggtggacctgaca
gcgggtgtgtcggccgataccaccgtcgccgcgctggaggagatgcgcaccgccagcgtc
gagttggtttgcagctcctga

DBGET integrated database retrieval system