KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_01938Help
Entry
TBMG_01938        CDS       T00940                                 

Definition
pyrazinamidase/nicotinamidas pncA
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mtb00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2127473..2128033
Genome map
AA seq 186 aa AA seqDB search
MRALIIVDVQNDFCEGGSLAVTGGAALARAISDYLAEAADYHHVVATKDFHIDPGDHFSG
TPDYSSSWPPHCVSGTPGADFHPSLDTSAIEAVFYKGAYTGAYSGFEGVDENGTPLLNWL
RQRGVDEVDVVAIATDHCVRQTAEDAVRNGLATRVLVDLTAGVSADTTVAALEEMRTASV
ELVCSS
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgttgatcatcgtcgacgtgcagaacgacttctgcgagggtggctcgctggcg
gtaaccggtggcgccgcgctggcccgcgccatcagcgactacctggccgaagcggcggac
taccatcacgtcgtggcaaccaaggacttccacatcgacccgggtgaccacttctccggc
acaccggactattcctcgtcgtggccaccgcattgcgtcagcggtactcccggcgcggac
ttccatcccagtctggacacgtcggcaatcgaggcggtgttctacaagggtgcctacacc
ggagcgtacagcggcttcgaaggagtcgacgagaacggcacgccactgctgaattggctg
cggcaacgcggcgtcgatgaggtcgatgtggtcgctattgccaccgatcattgtgtgcgc
cagacggccgaggacgcggtacgcaatggcttggccaccagggtgctggtggacctgaca
gcgggtgtgtcggccgataccaccgtcgccgcgctggaggagatgcgcaccgccagcgtc
gagttggtttgcagctcctga

DBGET integrated database retrieval system