KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_02052Help
Entry
TBMG_02052        CDS       T00940                                 

Definition
riboflavin biosynthesis protein ribA1
Orthology
K14652  
3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
Riboflavin metabolism
Metabolic pathways
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Class
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:mtb00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2229406..2230467)
Genome map
AA seq 353 aa AA seqDB search
MKTTDVRVRRAITAMAGGHAVVLTGDPNGDGYLVFAAQAATPRLVAFAVRHTSGYLRVAL
PGAECERLHLPPMCDRDTTHCVSVDVRGTGTGISASDRAWTIAALASATSVAADFQRPGH
VVPVQAQADGVLGRRGPAEAAVDLARLAERRPAAALCEIVSPDNPVQMAHHAESVEFAVE
HGLAMVSIGELVAYRRRIEPQVVRFTAATLPTWASASRVIGFRDVYDLGEHLAVIVGAVG
AGVPVPLHVHIECLTGDVFGSTACRCGEELNGALARMSAQGSGVVLYLRPPGPAQACGLF
ARGDAATDVMPETVTWILRDLGVYAIRLSDDVPGFGLVMFGAIREASTLAAAG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgaccgatgtgcgggtacgtcgtgcgatcacggcgatggcgggcggtcacgcc
gtggtcctgaccggcgaccccaatggcgatggctatctcgtcttcgccgcccaggccgcg
acgccgcggctggttgcctttgcggtccggcacacctcgggttatttgcgcgtcgcgctg
ccgggcgccgaatgcgagcgactgcacctgccgcccatgtgtgaccgagacaccacgcat
tgcgtgtcggtcgacgttcgcggcaccggcaccggaatctcggcgagcgatcgcgcctgg
accatcgcggcactggcttcggccacctccgtcgccgccgatttccaacgtccgggccat
gtggtgcccgtgcaggcgcaagccgacggtgtgctgggtcggcggggacccgccgaggcg
gccgtcgacctggcccgcctggcggaacggcggccggccgccgcgctctgcgagatcgtc
tcgcccgataatcccgtccagatggcgcaccacgccgagtcggtcgaattcgccgtcgaa
cacggactggccatggtctcgatcggggagctggtggcgtatcgccggcggatcgagccc
caggtggtccggtttacggcagcgacgctgcccacctgggccagcgcctcgcgtgtcatc
ggctttcgtgacgtttacgacctcggcgagcatttggcggtcatcgtgggtgcggtcggt
gccggggtgcccgtgccgctgcacgtccacatcgagtgcctgacgggcgacgtgttcggc
tcgacggcgtgccgctgcggcgaggaactcaacggcgcgctggcgaggatgtcggctcag
ggcagcggcgtggtcttgtatctgcgtccgcccggacccgcgcaagcgtgcggcttgttc
gcccggggcgatgcggcgaccgatgtcatgccggagaccgtgacatggatcctgcgcgat
cttggggtgtatgcgatccgactttccgatgatgtgccaggatttgggcttgtcatgttc
ggggcgatccgagaagccagcacgttggcggccgcaggttga

DBGET integrated database retrieval system