KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_02157Help
Entry
TBMG_02157        CDS       T00940                                 

Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TBMG_02157
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TBMG_02157
   00630 Glyoxylate and dicarboxylate metabolism
    TBMG_02157
Enzymes [BR:mtb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TBMG_02157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
2335962..2338169
Genome map
AA seq 735 aa AA seqDB search
MGNLRIARVLYDFVNNEALPGTDIDPDSFWAGVDKVVADLTPQNQALLNARDELQAQIDK
WHRRRVIEPIDMDAYRQFLTEIGYLLPEPDDFTITTSGVDAEITTTAGPQLVVPVLNARF
ALNAANARWGSLYDALYGTDVIPETDGAEKGPTYNKVRGDKVIAYARKFLDDSVPLSSGS
FGDATGFTVQDGQLVVALPDKSTGLANPGQFAGYTGAAESPTSVLLINHGLHIEILIDPE
SQVGTTDRAGVKDVILESAITTIMDFEDSVAAVDAADKVLGYRNWLGLNKGDLAAAVDKD
GTAFLRVLNRDRNYTAPGGGQFTLPGRSLMFVRNVGHLMTNDAIVDTDGSEVFEGIMDAL
FTGLIAIHGLKASDVNGPLINSRTGSIYIVKPKMHGPAEVAFTCELFSRVEDVLGLPQNT
MKIGIMDEERRTTVNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGPMVRKGTMKSQ
PWILAYEDHNVDAGLAAGFSGRAQVGKGMWTMTELMADMVETKIAQPRAGASTAWVPSPT
AATLHALHYHQVDVAAVQQGLAGKRRATIEQLLTIPLAKELAWAPDEIREEVDNNCQSIL
GYVVRWVDQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVITSADVRASLERMA
PLVDRQNAGDVAYRPMAPNFDDSIAFLAAQELILSGAQQPNGYTEPILHRRRREFKARAA
EKPAPSDRAGDDAAR
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
gtgggcaacttgcgcatcgctcgggtgctctacgacttcgtgaacaatgaagccctgcct
ggcaccgatatcgacccggacagcttctgggcgggcgtcgacaaggtcgtcgccgacctg
accccgcagaaccaagctctgttgaacgcccgcgacgagctgcaggcgcagatcgacaag
tggcaccggcgtcgggtgatcgagcccatcgacatggatgcctaccgccagttcctcacc
gagatcggctacctgcttcccgaacctgatgacttcaccatcaccacgtccggtgtcgac
gctgagatcaccacgaccgccggcccccagctggtggtgccggtgctcaacgcgcggttt
gctctgaacgcggccaacgctcgctggggctccctctacgacgccttgtatggcaccgat
gtcatccccgagaccgacggcgccgaaaaaggccccacgtacaacaaggttcgtggcgac
aaggtgatcgcgtatgcccgcaagttcctcgacgacagtgttccgctgtcgtcgggttcc
tttggcgacgccaccggtttcacagtgcaggatggccagctcgtggttgccttgccggat
aagtccaccggcctggccaaccccggccagttcgccggctacaccggcgcagccgagtcg
ccgacatcggtgctgctaatcaatcacggtttgcacatcgagatcctgatcgatccggag
tcgcaggtcggcaccaccgaccgggccggcgtcaaggacgtgatcctggaatccgcgatc
accacgatcatggacttcgaggactcggtggccgccgtggacgccgccgacaaggtgctg
ggttatcggaactggctcggcctgaacaagggcgacctggcagcagcggtagacaaggac
ggcaccgctttcctgcgggtgctcaatagggaccggaactacaccgcacccggcggtggc
cagttcacgctgcctggacgcagcctcatgttcgtccgcaacgtcggtcacttgatgacg
aatgacgccatcgtcgacactgacggcagcgaggtgttcgaaggcatcatggatgcccta
ttcaccggcctgatcgccatccacgggctaaaggccagcgacgtcaacgggccgctgatc
aacagccgcaccggctccatctacatcgtcaagccgaagatgcacggtccggccgaggtg
gcgtttacctgcgaactgttcagccgggttgaagatgtgctggggttgccgcaaaacacc
atgaagatcggcatcatggacgaggaacgccggaccacggtcaacctcaaggcgtgcatc
aaagctgccgcggaccgcgtggtgttcatcaacaccgggttcctggaccgcaccggcgat
gaaatccacacctcgatggaggccggcccgatggtgcgcaagggcaccatgaagagccag
ccgtggatcttggcctacgaggaccacaacgtcgatgccggcctggccgccgggttcagc
ggccgagcccaggtcggcaagggcatgtggacaatgaccgagctgatggccgacatggtc
gagacaaaaatcgcccagccgcgcgccggggccagcaccgcctgggttccctctcccact
gcggccaccctgcatgcgctgcactaccaccaggtcgacgtcgccgcggtgcaacaagga
ctggcggggaagcgtcgcgccaccatcgaacaattgctgaccattccgctggccaaggaa
ttggcctgggctcccgacgagatccgcgaagaggtcgacaacaactgtcaatccatcctc
ggctacgtggttcgctgggttgatcaaggtgtcggctgctcgaaggtgcccgacatccac
gacgtcgcgctcatggaggaccgggccacgctgcgaatctccagccaattgttggccaac
tggctgcgccacggtgtgatcaccagcgcggatgtgcgggccagcttggagcggatggcg
ccgttggtcgatcgacaaaacgcgggcgacgtggcataccgaccgatggcacccaacttc
gacgacagtatcgccttcctggccgcgcaggagctgatcttgtccggggcccagcagccc
aacggctacaccgagccgatcctgcaccgacgtcgtcgggagtttaaggcccgggccgct
gagaagccggccccatcggacagggccggtgacgatgcggcccgctag

DBGET integrated database retrieval system