KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_02215Help
Entry
TBMG_02215        CDS       T00940                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TBMG_02215
Enzymes [BR:mtb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TBMG_02215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2406751..2408109
Genome map
AA seq 452 aa AA seqDB search
MTELAPSLVELARRFGIATEYTDWTGRQVLVSEATLVAALAALGVPAQTEQQRNDALAAQ
LRSYWARPLPATIVMRAGEQTQFRVHVTDGAPADVWLQLEDGTTRAEVVQVDNFTPPFDL
DGRWIGEASFVLPADLPLGYHRVNLRSGDSQASAAVVVTPDWLGLPDKLAGRRAWGLAVQ
LYSVRSRQSWGIGDLTDLANLALWSASAHGAGYVLVNPLHAATLPGPAGRSKPIEPSPYL
PTSRRFVNPLYLRVEAIPELVDLPKRGRVQRLRTNVQQHADQLDTIDRDSAWAAKRAALK
LVHRVPRSAGRELAYAAFRTREGRALDDFATWCALAETYGDDWHRWPKSLRHPDASGVAD
FVDKHADAVDFHRWLQWQLDEQLASAQSQALRAGMSLGIMADLAVGVHPNGADAWALQDV
LAQGVTAGAPPDEFNQLGQDWSQPPWRPGPAR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagctcgcgccttcgctggtcgaacttgcccgacgattcggcattgccaccgag
tacacggactggactggccggcaggtgctggtctccgaggctacattggtggctgctctt
gccgccctcggcgttcccgcccagaccgaacagcaacgcaatgacgccctggccgcgcag
ctgcgatcctactgggcgcgtccattgccggcgaccatcgtcatgcgcgccggagagcag
acgcagttcagggtgcatgtgaccgatggcgctccggccgacgtgtggttgcagctcgag
gacggcacgacacgtgccgaggtggtgcaggtcgacaatttcaccccgccattcgatctt
gacggacgctggatcggcgaggccagcttcgtgttgcccgccgacctgcccctcggctac
caccgggtgaatctgcgttcgggcgactcgcaggccagcgccgctgttgtcgtgacgccg
gattggttggggctgccggacaagctggcaggccgtcgtgcctggggcctggccgtccag
ctctacagcgtgcggtcccggcagtcatggggcatcggggatctcaccgatttggcgaat
ctcgcgctgtggtcggcgtctgcgcacggtgccggctatgtgctggtcaatcccctgcat
gcggctacgcttcccgggcccgctgggcgctcgaagccaatcgaaccatcgccctacctg
ccgacatcgcgacgcttcgtcaaccctctctaccttcgggtggaggccattccggaactc
gtcgatctgcccaagcgtggccgggtgcaacggttgcgcaccaacgtgcaacagcacgcc
gaccagctcgacaccattgaccgcgacagcgcctgggcggccaaacgcgcagcactcaag
ctcgtgcaccgggtgccgcggtcggcgggtcgcgagctggcctacgccgccttccgtacc
cgcgagggccgcgccctcgacgacttcgccacctggtgcgcgctggccgagacgtacggc
gatgattggcatcgatggccgaaatcgctgcggcatcccgatgcctcaggtgtcgccgat
ttcgtcgacaaacacgccgatgccgtcgatttccaccgctggctgcagtggcagctggac
gagcagctcgccagtgcgcagtcgcaggcgctccgggccggcatgtcgctgggcatcatg
gcagacctcgccgttggcgtgcaccccaacggggccgacgcctgggctctgcaggacgtg
ctggcccaaggtgtgaccgcaggtgcgccgccggatgagttcaaccaactcggccaggac
tggtcgcagccaccgtggcggcccggaccggctcgctga

DBGET integrated database retrieval system