KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_02381Help
Entry
TBMG_02381        CDS       T00940                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TBMG_02381 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TBMG_02381 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TBMG_02381 (trpA)
Enzymes [BR:mtb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TBMG_02381 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2609541..2610353)
Genome map
AA seq 270 aa AA seqDB search
MVAVEQSEASRLGPVFDSCRANNRAALIGYLPTGYPDVPASVAAMTALVESGCDIIEVGV
PYSDPGMDGPTIARATEAALRGGVRVRDTLAAVEAISIAGGRAVVMTYWNPVLRYGVDAF
ARDLAAAGGLGLITPDLIPDEAQQWLAASEEHRLDRIFLVAPSSTPERLAATVEASRGFV
YAASTMGVTGARDAVSQAAPELVGRVKAVSDIPVGVGLGVRSRAQAAQIAQYADGVIVGS
ALVTALTEGLPRLRALTGELAAGVRLGMSA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggtggaacagagcgaagcaagtaggctcgggccggttttcgattcctgccgt
gcaaacaaccgcgcggcattgattggttacttgccgaccgggtacccggacgtgccagcg
tcggtggccgcgatgacagcgctagttgaatccggttgcgacattatcgaagtcggggtt
ccgtattcggacccgggcatggacggccccaccatcgccagggcaaccgaggcggcgctc
cgtggcggggtgcgagtccgggatacgttagccgcggtcgaggccatcagtatcgccggc
gggcgtgcggtagtgatgacctactggaatccggtgctgcgctatggggttgatgcattc
gcgcgggatctggcggcggccggaggactcggcctgatcactcctgacctcattcccgac
gaggcgcaacagtggctggcggcatccgaagagcatcggttggatcgcattttcttggtc
gcgccgtcctcgacaccggagcggttggcggccaccgtcgaggcttcacgcgggttcgtc
tacgcggcgtcgacgatgggggtgaccggggcgcgggatgcggtgtcgcaggcggcaccc
gaactggtgggccgggtgaaggcggtgtctgacataccggtgggcgtcggtctgggtgtg
cggtcgcgcgctcaagccgcgcagatcgcccaatacgccgacggtgtcatcgttggttcc
gcattggtgacggcgctaaccgaggggttgcctagattgcgggcactgaccggagagctc
gctgccggggtacgactagggatgtccgcatga

DBGET integrated database retrieval system