KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_02382Help
Entry
TBMG_02382        CDS       T00940                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TBMG_02382
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TBMG_02382
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TBMG_02382
Enzymes [BR:mtb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TBMG_02382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2610353..2611621)
Genome map
AA seq 422 aa AA seqDB search
MMTDLSTPDLPRMSAAIAEPTSHDPDSGGHFGGPSGWGGRYVPEALMAVIEEVTAAYQKE
RVSQDFLDDLDRLQANYAGRPSPLYEATRLSQHAGSARIFLKREDLNHTGSHKINNVLGQ
ALLARRMGKTRVIAETGAGQHGVATATACALLGLDCVIYMGGIDTARQALNVARMRLLGA
EVVAVQTGSKTLKDAINEAFRDWVANADNTYYCFGTAAGPHPFPTMVRDFQRIIGMEARV
QIQGQAGRLPDAVVACVGGGSNAIGIFHAFLDDPGVRLVGFEAAGDGVETGRHAATFTAG
SPGAFHGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHAWLKEAGRVDYRPITDSEAMD
AFGLLCRMEGIIPAIESAHAVAGALKLGVELGRGAVIVVNLSGRGDKDVETAAKWFGLLG
ND
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgatgacagatctatccaccccggatcttccgcgcatgagtgctgccatcgccgaaccg
accagtcacgatcctgattccggcggccatttcggcggccccagtggttggggtggccgc
tacgttcccgaggcgctgatggcggtgatcgaagaggtcaccgccgcctaccaaaaggag
cgcgtcagccaggactttctggacgacctagacaggctgcaggcgaactatgcgggccgg
ccttcgccgctttacgaggcgacccggttgagccagcacgctgggtcggcgcgaatcttt
ctgaagcgagaagacctgaaccatactggttctcacaagatcaacaacgtgctcgggcag
gcactgctggcgcgcaggatgggcaagacccgggtgatcgccgagaccggtgccggccag
cacggggtcgccacggccaccgcatgcgcattgctcggcctggactgtgtcatctacatg
gggggcatcgacaccgcccgtcaggcgctaaacgtggcccggatgcgattgctgggtgcc
gaagtcgtcgcggttcagacgggctcgaaaacgctcaaagacgccatcaatgaggcgttc
cgggattgggttgccaacgccgacaacacctactactgctttggtactgcggccggaccg
catccgtttccaaccatggtgcgcgatttccagcgaatcatcggcatggaggcacgtgtg
cagatccagggtcaggccggtcggctgcctgacgccgtcgtcgcgtgcgttggtggcggg
tccaatgccattggtatttttcatgcgtttctcgatgacccaggcgtacggctggtcgga
ttcgaggcagccggcgacggcgttgagaccggccggcatgccgcgacattcaccgctggt
tcgcccggggcatttcacggatcgttctcgtacttgctgcaagacgaggacggtcagacc
attgaatcccattcaatttccgcgggtctggattatccgggggtgggcccggaacatgcg
tggctcaaggaggccgggcgtgtcgattatcggccgatcaccgactccgaggcgatggac
gcgtttggcctgctgtgtcgcatggaaggcatcatcccggctattgaatccgcgcacgcg
gtggccggcgccctcaagctaggtgttgagttgggaaggggcgcggtgattgtggtgaac
ctgtcgggacgtggcgacaaagatgtcgagacggccgcgaaatggtttggcttgctgggc
aacgactga

DBGET integrated database retrieval system