KEGG   Mycobacterium tuberculosis KZN 1435: TBMG_02383Help
Entry
TBMG_02383        CDS       T00940                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase trpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mtb  Mycobacterium tuberculosis KZN 1435
Pathway
mtb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtb01100  Metabolic pathways
mtb01110  Biosynthesis of secondary metabolites
mtb01130  Biosynthesis of antibiotics
mtb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TBMG_02383
Enzymes [BR:mtb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     TBMG_02383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS OMPdecase FMN_dh
Motif
Other DBs
NCBI-ProteinID: ACT25457
Structure
PDB: 

Jmol
Position
complement(2611654..2612502)
Genome map
AA seq 282 aa AA seqDB search
MGDSGKGTAGMSPATVLDSILEGVRADVAAREASVSLSEIKAAAAAAPPPLDVMAALREP
GIGVIAEVKRASPSAGALATIADPAKLAQAYQDGGARIVSVVTEQRRFQGSLDDLDAVRA
SVSIPVLRKDFVVQPYQIHEARAHGADMLLLIVAALEQSVLVSMLDRTESLGMTALVEVH
TEQEADRALKAGAKVIGVNARDLMTLDVDRDCFARIAPGLPSSVIRIAESGVRGTADLLA
YAGAGADAVLVGEGLVTSGDPRAAVADLVTAGTHPSCPKPAR
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgacagtgggaagggaacggcaggcatgagtccggcaaccgtgctcgactccatc
ctcgagggagtccgggccgacgttgccgcgcgtgaagcctcggtgagcctgtcggagatc
aaggctgccgccgctgcggcgccgccgccgctcgacgtgatggccgccctacgcgagccc
ggcatcggcgtcatcgctgaggtcaagcgcgctagtccttcggcaggcgcattggcgacc
atcgccgacccggcaaagctggcccaggcctaccaggatggcggtgcccggatcgtcagc
gtggtgactgagcagcggcgttttcagggatcgctcgacgacctcgacgcggtgcgggcc
tcggtttcgattccggtgctgcgcaaggactttgtggtgcagccgtaccagattcatgag
gcgcgtgcgcacggcgccgacatgttgttgctcatcgtcgccgcattggagcagtcggtg
ttggtgtcgatgttggaccgcaccgaatcgttgggtatgacagcactcgtcgaggtccat
accgagcaggaagccgaccgagcgctgaaggccggggccaaggtgattggcgttaacgcc
cgcgacctcatgacgctggacgtggaccgggattgcttcgcgcgaatagctcctggtttg
ccgagcagtgtgatcaggattgctgaatccggcgtgcgtggcaccgctgacctgctggcg
tacgccggcgcgggcgctgacgcggtgttggtaggcgaaggtctggtcaccagcggcgac
ccacgtgccgcggttgccgatctggttaccgcgggcacccatccgtcctgtccgaaaccg
gctcgctag

DBGET integrated database retrieval system